Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, mouse liver tissue, rat liver tissue |
| Positive IHC detected in | mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IHC | See 1 publications below |
Product Information
84655-5-RR targets CXCR3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg2269 Product name: Recombinant Human CXCR3 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 1-53 aa of BC034403 Sequence: MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDR Predict reactive species |
| Full Name | chemokine (C-X-C motif) receptor 3 |
| Calculated Molecular Weight | 368 aa, 41 kDa |
| Observed Molecular Weight | 45 kDa |
| GenBank Accession Number | BC034403 |
| Gene Symbol | CXCR3 |
| Gene ID (NCBI) | 2833 |
| RRID | AB_3743632 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | P49682 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CXCR3 (C-X-C chemokine receptor type 3) is a G protein-coupled, seven-transmembrane domain chemokine receptor that is expressed on the surface of several cell types, including activated CD4+ and CD8+ T cells, NK and NK-T cells, plasmacytoid dendritic cells, and some B cells (PMID: 16847335). CXCR3 binds and is activated by the three IFN-gamma-inducible chemokines: CXCL9, CXCL10, and CXCL11. The binding of these ligands to CXCR3 has been implicated in regulating T-cell infiltration during inflammation and tissue injury (PMID: 17250586). Alternatively, spliced transcript variants encoding different isoforms have been found for this gene. One of the isoforms, CXCR3B, mediates the angiostatic activity of CXCR3 ligands and also acts as a functional receptor for CXCL4 (PMID:12782716).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CXCR3 antibody 84655-5-RR | Download protocol |
| WB protocol for CXCR3 antibody 84655-5-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









