CoraLite® Plus 488-conjugated CXCR7 Monoclonal antibody

CXCR7 Monoclonal Antibody for IF/ICC
Cat No. CL488-60216
Clone No.4C3D7

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse

Applications

IF/ICC

ACKR3, Atypical chemokine receptor 3, Chemokine orphan receptor 1, CMKOR1, C-X-C chemokine receptor type 7

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inSW480 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-60216 targets CXCR7 in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag14247

Product name: Recombinant human CXCR7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 273-362 aa of BC036661

Sequence: LLDIFSILHYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK

Predict reactive species
Full Name chemokine (C-X-C motif) receptor 7
Calculated Molecular Weight 362 aa, 41 kDa
Observed Molecular Weight 50-60 kDa
GenBank Accession NumberBC036661
Gene Symbol CXCR7
Gene ID (NCBI) 57007
RRIDAB_3672862
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP25106
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CXCR7 (C-X-C chemokine receptor type 7), also known as RDC1, is a member of the G-protein coupled receptor family. CXCR7 can bind the chemokines CXCL11 and CXCL12 with high affinity, and it also acts as coreceptor with CXCR4 for a restricted number of HIV isolates. Expression of CXCR7 has been associated with cardiac development as well as with tumor growth and progression. This antibody recognizes endogenous CXCR7, which has an experimentally determined molecular weight of 50 kDa (PMID: 20197403; 20388803).

Loading...
||
New chat Able
正在加载,请稍候...