Tested Applications
Positive IF/ICC detected in | SW480 cells |
Recommended dilution
Application | Dilution |
---|---|
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL488-60216 targets CXCR7 in IF/ICC applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Mouse / IgG2b |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14247 Product name: Recombinant human CXCR7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 273-362 aa of BC036661 Sequence: LLDIFSILHYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK Predict reactive species |
Full Name | chemokine (C-X-C motif) receptor 7 |
Calculated Molecular Weight | 362 aa, 41 kDa |
Observed Molecular Weight | 50-60 kDa |
GenBank Accession Number | BC036661 |
Gene Symbol | CXCR7 |
Gene ID (NCBI) | 57007 |
RRID | AB_3672862 |
Conjugate | CoraLite® Plus 488 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P25106 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
CXCR7 (C-X-C chemokine receptor type 7), also known as RDC1, is a member of the G-protein coupled receptor family. CXCR7 can bind the chemokines CXCL11 and CXCL12 with high affinity, and it also acts as coreceptor with CXCR4 for a restricted number of HIV isolates. Expression of CXCR7 has been associated with cardiac development as well as with tumor growth and progression. This antibody recognizes endogenous CXCR7, which has an experimentally determined molecular weight of 50 kDa (PMID: 20197403; 20388803).
Protocols
Product Specific Protocols | |
---|---|
IF protocol for CL Plus 488 CXCR7 antibody CL488-60216 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |