Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27925-1-AP targets CYFIP1 in WB, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.
| Tested Reactivity | Human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27419 Product name: Recombinant human CYFIP1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 130-393 aa of BC005097 Sequence: RNAIERFCGEVRRLCHAERRKDFVSEAYLITLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNKITQSLQQQLEVISGYEELLADIVNLCVDYYENRMYLTPSEKHMLLKVMGFGLYLMDGSVSNIYKLDAKKRINLSKIDKYFKQLQVVPLFGDMQIELARYIKTSAHYEENKSRWTCTSSGSSPQYNICEQMIQIREDHMRFISELARYSNSEVVTGSGRQEAQKTDAEYRKLFDL Predict reactive species |
| Full Name | cytoplasmic FMR1 interacting protein 1 |
| Calculated Molecular Weight | 1253 aa, 145 kDa |
| Observed Molecular Weight | 140-145 kDa |
| GenBank Accession Number | BC005097 |
| Gene Symbol | CYFIP1 |
| Gene ID (NCBI) | 23191 |
| RRID | AB_3086011 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q7L576 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CYFIP1 is a protein that regulates cytoskeletal dynamics and protein translation. The encoded protein is a component of the WAVE regulatory complex (WRC), which promotes actin polymerization. This protein also interacts with the synaptic functional regulator FMR1 protein and translation initiation factor 4E to inhibit protein translation. A large chromosomal deletion including this gene is associated with increased risk of schizophrenia and epilepsy in human patients. Reduced expression of this gene has been observed in various human cancers and the encoded protein may inhibit tumor invasion.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CYFIP1 antibody 27925-1-AP | Download protocol |
| WB protocol for CYFIP1 antibody 27925-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



