CYLD Monoclonal antibody

CYLD Monoclonal Antibody for WB, IF/ICC, ELISA
Cat No. 66858-1-Ig
Clone No.1G2F4

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat, pig, rabbit

Applications

WB, IF/ICC, ELISA

CDMT, CYLD, CYLD1, CYLDI, Deubiquitinating enzyme CYLD, EAC, FLJ20180, FLJ31664, FLJ78684, HSPC057, KIAA0849, MFT, MFT1, SBS, TEM, Ubiquitin thiolesterase CYLD, USPL2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inpig brain tissue, HEK-293 cells, A431 cells, rat brain tissue, mouse brain tissue, rabbit brain tissue
Positive IF/ICC detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66858-1-Ig targets CYLD in WB, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat, pig, rabbit samples.

Tested Reactivity Human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28333

Product name: Recombinant human CYLD protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 654-953 aa of BC012342

Sequence: TKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECYDDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSLPKDLPDWDWRHGCIPCQNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK

Predict reactive species
Full Name cylindromatosis (turban tumor syndrome)
Calculated Molecular Weight 107 kDa
Observed Molecular Weight 110 kDa
GenBank Accession NumberBC012342
Gene Symbol CYLD
Gene ID (NCBI) 1540
RRIDAB_2882197
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NQC7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CYLD, also named as CYLD1, belongs to the peptidase C67 family. It is the protease that specifically cleaves 'Lys-63'-linked polyubiquitin chains. CYLD has endodeubiquitinase activity and plays an important role in the regulation of pathways leading to NF-kappa-B activation. CYLD contributes to the regulation of cell survival, proliferation and differentiation via its effects on NF-kappa-B activation. It is a negative regulator of Wnt signaling. CYLD inhibits HDAC6 and thereby promotes acetylation of alpha-tubulin and stabilization of microtubules. CYLD plays a role in the regulation of microtubule dynamics, and thereby contributes to the regulation of cell proliferation, cell polarization, cell migration, and angiogenesis. It is required for normal cell cycle progress and normal cytokinesis. CYLD inhibits nuclear translocation of NF-kappa-B and plays a role in the regulation of inflammation and the innate immune response, via its effects on NF-kappa-B activation. It is dispensable for the maturation of intrathymic natural killer cells, but required for the continued survival of immature natural killer cells. CYLD negatively regulates TNFRSF11A signaling and osteoclastogenesis.

Protocols

Product Specific Protocols
IF protocol for CYLD antibody 66858-1-IgDownload protocol
WB protocol for CYLD antibody 66858-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...