CYLD Monoclonal antibody, PBS Only

CYLD Monoclonal Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 66858-1-PBS
Clone No.1G2F4

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat, pig, rabbit

Applications

WB, IF/ICC, Indirect ELISA

CDMT, CYLD, CYLD1, CYLDI, Deubiquitinating enzyme CYLD, EAC, FLJ20180, FLJ31664, FLJ78684, HSPC057, KIAA0849, MFT, MFT1, SBS, TEM, Ubiquitin thiolesterase CYLD, USPL2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66858-1-PBS targets CYLD in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human, mouse, rat, pig, rabbit samples.

Tested Reactivity Human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28333

Product name: Recombinant human CYLD protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 654-953 aa of BC012342

Sequence: TKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECYDDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSLPKDLPDWDWRHGCIPCQNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK

Predict reactive species
Full Name cylindromatosis (turban tumor syndrome)
Calculated Molecular Weight 107 kDa
Observed Molecular Weight 110 kDa
GenBank Accession NumberBC012342
Gene Symbol CYLD
Gene ID (NCBI) 1540
RRIDAB_2882197
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NQC7
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CYLD, also named as CYLD1, belongs to the peptidase C67 family. It is the protease that specifically cleaves 'Lys-63'-linked polyubiquitin chains. CYLD has endodeubiquitinase activity and plays an important role in the regulation of pathways leading to NF-kappa-B activation. CYLD contributes to the regulation of cell survival, proliferation and differentiation via its effects on NF-kappa-B activation. It is a negative regulator of Wnt signaling. CYLD inhibits HDAC6 and thereby promotes acetylation of alpha-tubulin and stabilization of microtubules. CYLD plays a role in the regulation of microtubule dynamics, and thereby contributes to the regulation of cell proliferation, cell polarization, cell migration, and angiogenesis. It is required for normal cell cycle progress and normal cytokinesis. CYLD inhibits nuclear translocation of NF-kappa-B and plays a role in the regulation of inflammation and the innate immune response, via its effects on NF-kappa-B activation. It is dispensable for the maturation of intrathymic natural killer cells, but required for the continued survival of immature natural killer cells. CYLD negatively regulates TNFRSF11A signaling and osteoclastogenesis.

Loading...
||
New chat

Able

正在加载,请稍候...