Tested Applications
Positive WB detected in | A549 cells, Jurkat cells, rat brain tissue, HeLa cells, HepG2 cells, mouse adrenal gland tissue, mouse brain tissue |
Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:12000 |
Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 27 publications below |
IHC | See 15 publications below |
IF | See 15 publications below |
Product Information
14447-1-AP targets CYP17A1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, pig |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag5899 Product name: Recombinant human CYP17A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 160-508 aa of BC062997 Sequence: HNGQSIDISFPVFVAVTNVISLICFNTSYKNGDPELNVIQNYNEGIIDNLSKDSLVDLVPWLKIFPNKTLEKLKSHVKIRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNPAGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLPSLEGIPKVVFLIDSFKVKIKVRQAWREAQAEGST Predict reactive species |
Full Name | cytochrome P450, family 17, subfamily A, polypeptide 1 |
Calculated Molecular Weight | 57 kDa |
Observed Molecular Weight | 50-57 kDa |
GenBank Accession Number | BC062997 |
Gene Symbol | CYP17A1 |
Gene ID (NCBI) | 1586 |
RRID | AB_2292527 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P05093 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cytochrome P450 17A1 (CYP17A1) is a critical steroidogenic enzyme, essential for producing glucocorticoids and sex hormones (PMID: 33781841). The CYP17A1 gene is expressed in the adrenal cortex and the gonads but not in the placenta (PMID: 19403566). Although CYP17A1 has been shown to be a 50-kDa protein, the presence of a lower molecular mass(30 kDa) immunoreactive form in rat Leydig cells was previously shown and it is either a degradation product or a truncated form of the 50 kDa enzyme (PMID: 15761033). Defects in CYP17A1 are the cause of adrenal hyperplasia type 5 (AH5) and CYP17A1 is an important target for inhibition in the treatment of prostate cancer (PMID: 27505042).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CYP17A1 antibody 14447-1-AP | Download protocol |
IHC protocol for CYP17A1 antibody 14447-1-AP | Download protocol |
IF protocol for CYP17A1 antibody 14447-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Part Fibre Toxicol Chronic exposure to polystyrene microplastics induced male reproductive toxicity and decreased testosterone levels via the LH-mediated LHR/cAMP/PKA/StAR pathway. | ||
Biol Res Unraveling the impact of hyperleptinemia on female reproduction: insights from transgenic pig model | ||
J Cell Sci Transgenic GATA-4 expression induces adrenocortical tumorigenesis in C57Bl/6 mice. | ||
FASEB J Hydroxysteroid (17β)-dehydrogenase 1-deficient female mice present with normal puberty onset but are severely subfertile due to a defect in luteinization and progesterone production. | ||
Development WNT signaling in pre-granulosa cells is required for ovarian folliculogenesis and female fertility. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Hua (Verified Customer) (04-26-2024) | The size of the protein that the antibody recognizes in samples is much smaller than expected.
![]() |
FH Tom (Verified Customer) (08-25-2021) | 2 non-specific bands appear on membrane, but the correct band can be distinguished.
![]() |
FH Hailey (Verified Customer) (10-07-2019) | This antibody works very well for IF in mouse testis. We use Cyp17a1 as a marker for a lot of my experiments, and after comparing Cyp17a1 antibodies from many companies, this is our antibody of choice for IF. However for westerns, there is a pesky non-specific band that appears right below the correct band, and it is difficult to differentiate them unless you run the WB for a long time.
![]() |