CYP21A2 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• CYP21A2 Monoclonal antibody (67421-1-Ig)

CYP21A2 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67421-1-Ig Copied!

Clone No. 1G2G6

Publications (1)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, rat, pig

Applications

WB, IF/ICC, ELISA

Synonyms

1G2G6, CA21H, CAH1, CPS1, CYP21

• 

  WB analysis using 67421-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67421-1-Ig (CYP21A2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human adrenal gland using 67421-1-Ig

  human adrenal gland tissue were subjected to SDS PAGE followed by western blot with 67421-1-Ig (CYP21A2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of pig adrenal gland using 67421-1-Ig

  pig adrenal gland tissue were subjected to SDS PAGE followed by western blot with 67421-1-Ig (CYP21A2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-12 using 67421-1-Ig

  PC-12 cells were subjected to SDS PAGE followed by western blot with 67421-1-Ig (CYP21A2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of pig adrenal gland using 67421-1-Ig

  pig adrenal gland tissue were subjected to SDS PAGE followed by western blot with 67421-1-Ig (CYP21A2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of PC-12 using 67421-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed PC-12 cells using CYP21A2 antibody (67421-1-Ig, Clone: 1G2G6 ) at dilution of 1:800 and CoraLite®594-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CYP21A2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells, human adrenal gland tissue, PC-12 cells, pig adrenal gland tissue
• Positive IF/ICC detected in: PC-12 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67421-1-Ig targets CYP21A2 in WB, IF/ICC, ELISA applications and shows reactivity with human, rat, pig samples.

• Tested Reactivity: human, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26292

  Product name: Recombinant human CYP21A2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 103-202 aa of NM_000500

  Sequence: MNYPDLSLGDYSLLWKAHKKLTRSALLLGIRDSMEPVVEQLTQEFCERMRAQPGTPVAIEEEFSLLTCSIICYLTFGDKIKDDNLMPAYYKCIQEVLKTWS

• Full Name: cytochrome P450, family 21, subfamily A, polypeptide 2
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 53-56 kDa
• GenBank Accession Number: NM_000500
• Gene Symbol: CYP21A2
• Gene ID (NCBI): 1589
• RRID: AB_2882661
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P08686
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The CYP21A2 Monoclonal antibody (Cat# 67421-1-Ig) has 1 citation to date. It was cited in the journal Metabolism (Impact Factor 16.7) in a 2026 study by Xuyang Shi et al., titled "Proteomic profiling reveals novel insights into hypercortisolism adrenal adenomas." The research field encompasses endocrinology and adrenal pathology, specifically investigating proteomic changes in hypercortisolism-associated adrenal adenomas.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Metabolism; Proteomic profiling reveals novel insights into hypercortisolism adrenal adenomas.; Authors - Xuyang Shi