Tested Applications
Positive WB detected in | HepG2 cells, human adrenal gland tissue, PC-12 cells, pig adrenal gland tissue |
Positive IF/ICC detected in | PC-12 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:10000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
67421-1-Ig targets CYP21A2 in WB, IF/ICC, ELISA applications and shows reactivity with human, pig samples.
Tested Reactivity | human, pig |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26292 Product name: Recombinant human CYP21A2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 103-202 aa of NM_000500 Sequence: MNYPDLSLGDYSLLWKAHKKLTRSALLLGIRDSMEPVVEQLTQEFCERMRAQPGTPVAIEEEFSLLTCSIICYLTFGDKIKDDNLMPAYYKCIQEVLKTWS Predict reactive species |
Full Name | cytochrome P450, family 21, subfamily A, polypeptide 2 |
Calculated Molecular Weight | 56 kDa |
Observed Molecular Weight | 53-56 kDa |
GenBank Accession Number | NM_000500 |
Gene Symbol | CYP21A2 |
Gene ID (NCBI) | 1589 |
RRID | AB_2882661 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | P08686 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CYP21A2 antibody 67421-1-Ig | Download protocol |
IF protocol for CYP21A2 antibody 67421-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |