CYP27A1 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse liver using 14739-1-AP (same clone as 14739-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 14739-1-AP (CYP27A1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14739-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 14739-1-AP (same clone as 14739-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 14739-1-AP (CYP27A1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14739-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 14739-1-AP (same clone as 14739-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14739-1-AP (CYP27A1 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14739-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 14739-1-AP (same clone as 14739-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14739-1-AP (CYP27A1 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14739-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 14739-1-AP (same clone as 14739-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 14739-1-AP (CYP27A1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14739-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 14739-1-AP (same clone as 14739-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 14739-1-AP (CYP27A1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14739-1-PBS in a different storage buffer formulation.

CYP27A1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 14739-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Cytochrome P450 27, Cytochrome P 450C27/25, CYP27, CTX, CP27

---

Product Information

14739-1-PBS targets CYP27A1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6408

  Product name: Recombinant human CYP27A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 183-531 aa of BC051851

  Sequence: DDFMTRLDQLRAESASGNQVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPEDTVTFVRSIGLMFQNSLYATFLPKWTRPVLPFWKRYLDGWNAIFSFGKKLIDEKLEDMEAQLQAAGPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYHLSKDPEIQEALHEEVVGVVPAGQVPQHKDFAHMPLLKAVLKETLRLYPVVPTNSRIIEKEIEVDGFLFPKNTQFVFCHYVVSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQC

• Full Name: cytochrome P450, family 27, subfamily A, polypeptide 1
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 60-65 kDa
• GenBank Accession Number: BC051851
• Gene Symbol: CYP27A1
• Gene ID (NCBI): 1593
• RRID: AB_2089276
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q02318
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Mitochondrial sterol 27-hydroxylase (CYP27A1) catalyzes oxidative cleavage of the sterol side chain in the bile acid biosynthetic pathway in the liver and 27-hydroxylation of cholesterol in most tissues(PMID:17088262). It belongs to the cytochrome P450 family. CYP27A1 catalyses an important sterol elimination pathway in the macrophage, and consequently may protect against atherosclerosis.