CYP27A1 Polyclonal antibody

• 

  WB analysis of L02 using 19195-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 19195-1-AP (CYP27A1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 19195-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 19195-1-AP (CYP27A1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human kidney using 19195-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 19195-1-AP (CYP27A1 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human kidney using 19195-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 19195-1-AP (CYP27A1 antibody) at dilution of 1:100 (under 40x lens).

CYP27A1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 19195-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

Synonyms

CP27, CTX, CYP27, CYP27A1, Cytochrome P 450C27/25, Cytochrome P450 27, Sterol 27 hydroxylase, Vitamin D(3) 25 hydroxylase

---

Tested Applications

• Positive WB detected in: L02 cells, HepG2 cells
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

19195-1-AP targets CYP27A1 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7746

  Product name: Recombinant human CYP27A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 183-531 aa of BC051851

  Sequence: DDFMTRLDQLRAESASGNQVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPEDTVTFVRSIGLMFQNSLYATFLPKWTRPVLPFWKRYLDGWNAIFSFGKKLIDEKLEDMEAQLQAAGPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYHLSKDPEIQEALHEEVVGVVPAGQVPQHKDFAHMPLLKAVLKETLRLYPVVPTNSRIIEKEIEVDGFLFPKNTQFVFCHYVVSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQC

• Full Name: cytochrome P450, family 27, subfamily A, polypeptide 1
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC051851
• Gene Symbol: CYP27A1
• Gene ID (NCBI): 1593
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q02318
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mitochondrial sterol 27-hydroxylase (CYP27A1) catalyzes oxidative cleavage of the sterol side chain in the bile acid biosynthetic pathway in the liver and 27-hydroxylation of cholesterol in most tissues(PMID:17088262). It belongs to the cytochrome P450 family. CYP27A1 catalyses an important sterol elimination pathway in the macrophage, and consequently may protect against atherosclerosis.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Toxicol Sci; Hepatic, metabolic and toxicity evaluation of repeated oral administration of SnS2 nanoflowers in mice.; Authors - Disi Bai