CYR61/CCN1 Monoclonal antibody, PBS Only

• 

  WB analysis using 67656-1-Ig (same clone as 67656-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67656-1-Ig (CYR61 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67656-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67656-1-Ig (same clone as 67656-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67656-1-Ig (CYR61 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67656-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67656-1-Ig (same clone as 67656-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67656-1-Ig (CYR61 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67656-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 67656-1-Ig (same clone as 67656-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 67656-1-Ig (CYR61 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67656-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 67656-1-Ig (same clone as 67656-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 67656-1-Ig (CYR61 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67656-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 67656-1-Ig (same clone as 67656-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed A431 cells using CYR61 antibody (67656-1-Ig, Clone: 2E11F11 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67656-1-PBS in a different storage buffer formulation.

CYR61/CCN1 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67656-1-PBS

Clone No.2E11F11

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

CYR61, 2E11F11, CCN family member 1, CCN1, Cellular communication network factor 1

---

Product Information

67656-1-PBS targets CYR61/CCN1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25129

  Product name: Recombinant human CYR61 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 165-239 aa of BC001271

  Sequence: EDSIKDPMEDQDGLLGKELGFDASEVELTRNNELIAVGKGSSLKRLPVFGMEPRILYNPLQGQKCIVQTTSWSQC

• Full Name: cysteine-rich, angiogenic inducer, 61
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 40-42 kDa
• GenBank Accession Number: BC001271
• Gene Symbol: CYR61
• Gene ID (NCBI): 3491
• RRID: AB_2882854
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O00622
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.