CYR61/CCN1 Monoclonal antibody

• 

  WB analysis using 67656-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67656-1-Ig (CYR61 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 67656-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67656-1-Ig (CYR61 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 67656-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67656-1-Ig (CYR61 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 67656-1-Ig

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 67656-1-Ig (CYR61 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 67656-1-Ig

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 67656-1-Ig (CYR61 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 67656-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed A431 cells using CYR61 antibody (67656-1-Ig, Clone: 2E11F11 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

CYR61/CCN1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67656-1-Ig

Clone No.2E11F11

Publications(6)

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CYR61, 2E11F11, CCN family member 1, CCN1, Cellular communication network factor 1

---

Tested Applications

• Positive WB detected in: U2OS cells, A431 cells, PC-3 cells, HeLa cells, MDA-MB-231 cells
• Positive IHC detected in: human liver cancer tissue, human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:20000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IHC: See 2 publications below

Product Information

67656-1-Ig targets CYR61/CCN1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25129

  Product name: Recombinant human CYR61 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 165-239 aa of BC001271

  Sequence: EDSIKDPMEDQDGLLGKELGFDASEVELTRNNELIAVGKGSSLKRLPVFGMEPRILYNPLQGQKCIVQTTSWSQC

• Full Name: cysteine-rich, angiogenic inducer, 61
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 40-42 kDa
• GenBank Accession Number: BC001271
• Gene Symbol: CYR61
• Gene ID (NCBI): 3491
• RRID: AB_2882854
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O00622
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Hum Cell; Long non-coding RNA CCAT2 drives the growth of laryngeal squamous cell carcinoma via regulating YAP activity.; Authors - Yanzi Zang
human	WB	Environ Toxicol; Inhibition of Ras protein activator like 2 produces antitumor effects in gastric cancer via the suppression of YAP1 activation; Authors - Yuan Hu
human	IHC	Biol Reprod; Human trophoblast invasion and migration are mediated by the YAP1-CCN1 pathway: defective signaling in trophoblasts during early-onset severe preeclampsia; Authors - Liang Wu
mouse,human	WB,IHC	J Orthop Translat; Targeting the senescence-related genes MAPK12 and FOS to alleviate osteoarthritis; Authors - Nana Geng
human	WB	MedComm (2020); Targeting CDK4/6 suppresses colorectal cancer by destabilizing YAP1; Authors - Yalei Wen
mouse	WB	Mech Ageing Dev; Cyr61 Promotes D-gal-induced Aging C2C12 Cell Fibrosis by Modulating Wnt/β-catenin Signaling Pathways; Authors - Xinchen Huang