Tested Applications
Positive WB detected in | U2OS cells, A431 cells, PC-3 cells, HeLa cells, MDA-MB-231 cells |
Positive IHC detected in | human liver cancer tissue, human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | A431 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:20000 |
Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 5 publications below |
IHC | See 2 publications below |
Product Information
67656-1-Ig targets CYR61/CCN1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25129 Product name: Recombinant human CYR61 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 165-239 aa of BC001271 Sequence: EDSIKDPMEDQDGLLGKELGFDASEVELTRNNELIAVGKGSSLKRLPVFGMEPRILYNPLQGQKCIVQTTSWSQC Predict reactive species |
Full Name | cysteine-rich, angiogenic inducer, 61 |
Calculated Molecular Weight | 42 kDa |
Observed Molecular Weight | 40-42 kDa |
GenBank Accession Number | BC001271 |
Gene Symbol | CYR61 |
Gene ID (NCBI) | 3491 |
RRID | AB_2882854 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | O00622 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CYR61/CCN1 antibody 67656-1-Ig | Download protocol |
IHC protocol for CYR61/CCN1 antibody 67656-1-Ig | Download protocol |
IF protocol for CYR61/CCN1 antibody 67656-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Hum Cell Long non-coding RNA CCAT2 drives the growth of laryngeal squamous cell carcinoma via regulating YAP activity. | ||
Environ Toxicol Inhibition of Ras protein activator like 2 produces antitumor effects in gastric cancer via the suppression of YAP1 activation | ||
Biol Reprod Human trophoblast invasion and migration are mediated by the YAP1-CCN1 pathway: defective signaling in trophoblasts during early-onset severe preeclampsia | ||
J Orthop Translat Targeting the senescence-related genes MAPK12 and FOS to alleviate osteoarthritis | ||
Mech Ageing Dev Cyr61 Promotes D-gal-induced Aging C2C12 Cell Fibrosis by Modulating Wnt/β-catenin Signaling Pathways |