Tested Applications
Positive WB detected in | rat heart tissue, mouse heart tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:16000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IF | See 2 publications below |
Product Information
27372-1-AP targets CYSLTR1 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24961 Product name: Recombinant human CYSLTR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 252-337 aa of BC035750 Sequence: QRTIHLHFLHNETKPCDSVLTMQKSVVITLSLAASNCCFDPLLYFFSGGNFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV Predict reactive species |
Full Name | cysteinyl leukotriene receptor 1 |
Calculated Molecular Weight | 39 kDa |
Observed Molecular Weight | 39 kDa |
GenBank Accession Number | BC035750 |
Gene Symbol | CYSLTR1 |
Gene ID (NCBI) | 10800 |
RRID | AB_2880856 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9Y271 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CYSLTR1 antibody 27372-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Exp Eye Res Distribution of the cysteinyl leukotriene system components in the human, rat and mouse eye | ||
J Pharm Biomed Anal Revealing the anti-inflammatory ingredients in wine-processed Radix et Rhizoma Rhei using immobilized cysteinyl leukotriene receptor type 1 as the stationary phase | ||
Int J Clin Exp Pathol Expression of cysteinyl leukotriene receptor in brain tissues of rats with Streptococcus pneumoniae meningitis. |