CYSLTR1 Polyclonal antibody

• 

  WB analysis using 27372-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27372-1-AP (CYSLTR1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 27372-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 27372-1-AP (CYSLTR1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat heart using 27372-1-AP

  rat heart tissue were subjected to SDS PAGE followed by western blot with 27372-1-AP (CYSLTR1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

CYSLTR1 Polyclonal Antibody for WB, ELISA

Cat No. 27372-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, ELISA

Synonyms

CYSLT1, CYSLT1R, CYSLTR, CYSLTR1, HG55, HMTMF81, LTD4 receptor

---

Tested Applications

• Positive WB detected in: rat heart tissue, mouse heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IF: See 2 publications below

Product Information

27372-1-AP targets CYSLTR1 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24961

  Product name: Recombinant human CYSLTR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 252-337 aa of BC035750

  Sequence: QRTIHLHFLHNETKPCDSVLTMQKSVVITLSLAASNCCFDPLLYFFSGGNFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV

• Full Name: cysteinyl leukotriene receptor 1
• Calculated Molecular Weight: 39 kDa
• Observed Molecular Weight: 39 kDa
• GenBank Accession Number: BC035750
• Gene Symbol: CYSLTR1
• Gene ID (NCBI): 10800
• RRID: AB_2880856
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y271
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Exp Eye Res; Distribution of the cysteinyl leukotriene system components in the human, rat and mouse eye; Authors - Susanne M Brunner
	IF	J Pharm Biomed Anal; Revealing the anti-inflammatory ingredients in wine-processed Radix et Rhizoma Rhei using immobilized cysteinyl leukotriene receptor type 1 as the stationary phase; Authors - Xuechao Li
rat	WB	Int J Clin Exp Pathol; Expression of cysteinyl leukotriene receptor in brain tissues of rats with Streptococcus pneumoniae meningitis.; Authors - Shuying Yu
rat	WB	Exp Ther Med; Blockade of cysteinyl leukotriene receptor 1 alleviates asthma by inhibiting bronchial epithelial cell apoptosis and activating the Nrf2 signaling pathway; Authors - Xiangjie Wu