CYSLTR1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CYSLTR1 Polyclonal antibody (27372-1-AP)

CYSLTR1 Polyclonal Antibody for WB, ELISA

Cat No. 27372-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, ELISA

Synonyms

CYSLT1, CYSLT1R, CYSLTR, CYSLTR1, HG55, HMTMF81, LTD4 receptor

• 

  WB analysis using 27372-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27372-1-AP (CYSLTR1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse heart using 27372-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 27372-1-AP (CYSLTR1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat heart using 27372-1-AP

  rat heart tissue were subjected to SDS PAGE followed by western blot with 27372-1-AP (CYSLTR1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CYSLTR1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: rat heart tissue, mouse heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27372-1-AP targets CYSLTR1 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24961

  Product name: Recombinant human CYSLTR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 252-337 aa of BC035750

  Sequence: QRTIHLHFLHNETKPCDSVLTMQKSVVITLSLAASNCCFDPLLYFFSGGNFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV

• Full Name: cysteinyl leukotriene receptor 1
• Calculated Molecular Weight: 39 kDa
• Observed Molecular Weight: 39 kDa
• GenBank Accession Number: BC035750
• Gene Symbol: CYSLTR1
• Gene ID (NCBI): 10800
• RRID: AB_2880856
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y271
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The CYSLTR1 Polyclonal antibody (Cat# 27372-1-AP) has 4 total citations published in J Pharm Biomed Anal, Exp Eye Res, Exp Ther Med, and Int J Clin Exp Pathol. These citations span pharmacological analysis of anti-inflammatory compounds, ocular distribution of cysteinyl leukotriene components, asthma pathophysiology involving bronchial epithelial apoptosis and Nrf2 signaling, and neuroinfectious disease (pneumococcal meningitis), reflecting applications in immunology, respiratory biology, ophthalmology, and infectious disease research.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IF	J Pharm Biomed Anal; Revealing the anti-inflammatory ingredients in wine-processed Radix et Rhizoma Rhei using immobilized cysteinyl leukotriene receptor type 1 as the stationary phase; Authors - Xuechao Li
human	IF	Exp Eye Res; Distribution of the cysteinyl leukotriene system components in the human, rat and mouse eye; Authors - Susanne M Brunner
rat	WB	Exp Ther Med; Blockade of cysteinyl leukotriene receptor 1 alleviates asthma by inhibiting bronchial epithelial cell apoptosis and activating the Nrf2 signaling pathway; Authors - Xiangjie Wu
rat	WB	Int J Clin Exp Pathol; Expression of cysteinyl leukotriene receptor in brain tissues of rats with Streptococcus pneumoniae meningitis.; Authors - Shuying Yu