Cadherin-6 Polyclonal antibody, PBS Only

• 

  WB analysis using 27703-1-AP (same clone as 27703-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27703-1-AP (Cadherin-6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27703-1-PBS in a different storage buffer formulation.

Cadherin-6 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27703-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

CDH6, Cadherin 6, K cadherin, KCAD, K-cadherin

---

Product Information

27703-1-PBS targets Cadherin-6 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26756

  Product name: Recombinant human CDH6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 619-663 aa of BC000019

  Sequence: ILLCIVILLGKLVLPASYLPMVRGSHCYCDTLDLSASPIKAYSLI

• Full Name: cadherin 6, type 2, K-cadherin (fetal kidney)
• Calculated Molecular Weight: 790 aa, 88 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: BC000019
• Gene Symbol: Cadherin-6
• Gene ID (NCBI): 1004
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P55285
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cadherins are a family of transmembrane glycoproteins that mediate calcium-dependent cell-cell adhesion and play an important role in the maintenance of normal tissue architecture. Cadherin-6 (CDH6), also known as K-cadherin, is a class II cadherin involved in the morphogenesis of the central nervous system and kidney (PMID: 27375021). Expression of cadherin-6 has also been described in some cancers, including renal cancer, ovarian cancer, gastric cancer, and thyroid cancer (PMID: 14665853; 28526733; 34530820). Cadherin-6 is involved in epithelial-mesenchymal transition (EMT) and cancer metastasis (PMID: 27375021).