Product Information
27703-1-PBS targets Cadherin-6 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26756 Product name: Recombinant human CDH6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 619-663 aa of BC000019 Sequence: ILLCIVILLGKLVLPASYLPMVRGSHCYCDTLDLSASPIKAYSLI Predict reactive species |
| Full Name | cadherin 6, type 2, K-cadherin (fetal kidney) |
| Calculated Molecular Weight | 790 aa, 88 kDa |
| Observed Molecular Weight | 130 kDa |
| GenBank Accession Number | BC000019 |
| Gene Symbol | Cadherin-6 |
| Gene ID (NCBI) | 1004 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P55285 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Cadherins are a family of transmembrane glycoproteins that mediate calcium-dependent cell-cell adhesion and play an important role in the maintenance of normal tissue architecture. Cadherin-6 (CDH6), also known as K-cadherin, is a class II cadherin involved in the morphogenesis of the central nervous system and kidney (PMID: 27375021). Expression of cadherin-6 has also been described in some cancers, including renal cancer, ovarian cancer, gastric cancer, and thyroid cancer (PMID: 14665853; 28526733; 34530820). Cadherin-6 is involved in epithelial-mesenchymal transition (EMT) and cancer metastasis (PMID: 27375021).

