Cadherin-6 Polyclonal antibody

• 

  WB analysis using 27703-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27703-1-AP (Cadherin-6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

Cadherin-6 Polyclonal Antibody for WB, ELISA

Cat No. 27703-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse, Rat

Applications

WB, ELISA

Synonyms

Cadherin 6, CDH6, K cadherin, KCAD, Kidney cadherin

---

Tested Applications

• Positive WB detected in: rat kidney tissue, mouse kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27703-1-AP targets Cadherin-6 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26756

  Product name: Recombinant human CDH6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 619-663 aa of BC000019

  Sequence: ILLCIVILLGKLVLPASYLPMVRGSHCYCDTLDLSASPIKAYSLI

• Full Name: cadherin 6, type 2, K-cadherin (fetal kidney)
• Calculated Molecular Weight: 790 aa, 88 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: BC000019
• Gene Symbol: Cadherin-6
• Gene ID (NCBI): 1004
• RRID: AB_3085988
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P55285
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cadherins are a family of transmembrane glycoproteins that mediate calcium-dependent cell-cell adhesion and play an important role in the maintenance of normal tissue architecture. Cadherin-6 (CDH6), also known as K-cadherin, is a class II cadherin involved in the morphogenesis of the central nervous system and kidney (PMID: 27375021). Expression of cadherin-6 has also been described in some cancers, including renal cancer, ovarian cancer, gastric cancer, and thyroid cancer (PMID: 14665853; 28526733; 34530820). Cadherin-6 is involved in epithelial-mesenchymal transition (EMT) and cancer metastasis (PMID: 27375021).