Calponin 1 Monoclonal antibody

• 

  WB analysis using 66540-1-Ig

  Various tissue were subjected to SDS PAGE followed by western blot with 66540-1-Ig (Calponin antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human myofibroblastoma using 66540-1-Ig

  Immunohistochemical analysis of paraffin-embedded human myofibroblastoma tissue slide using 66540-1-Ig (Calponin antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human myofibroblastoma using 66540-1-Ig

  Immunohistochemical analysis of paraffin-embedded human myofibroblastoma tissue slide using 66540-1-Ig (Calponin antibody) at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Calponin 1 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66540-1-Ig

Clone No.1A11E5

Publications(2)

Host / Isotype

Mouse / IgG2b

Reactivity

human and More (2)

Applications

WB, IHC, IF, ELISA

Synonyms

Calponin, CNN1, 1A11E5, Basic calponin, Calponin-1

---

Tested Applications

• Positive WB detected in: human heart tissue, human vein tissue, human colon tissue, human ileum tissue, human bladder tissue, human kidney tissue
• Positive IHC detected in: human myofibroblastoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1500-1:6000
• Immunohistochemistry (IHC): IHC : 1:150-1:600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IF: See 1 publications below

Product Information

66540-1-Ig targets Calponin 1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21384

  Product name: Recombinant human Calponin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 225-265 aa of BC022015

  Sequence: KRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPR

• Full Name: calponin 1, basic, smooth muscle
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 33-35 kDa
• GenBank Accession Number: BC022015
• Gene Symbol: Calponin
• Gene ID (NCBI): 1264
• RRID: AB_2881902
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P51911
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Calponin is a family of actin filament-associated proteins which regulate smooth muscle cell contraction. Three isoforms of calponin exist: calponin h1 (CNN1) , calponin h2 (CNN2) and calponin 3 (CNN3). CNN1 is a basic 34-kD protein specifically expressed in smooth muscle and a marker of smooth muscle cell differentiation. This antibody raised against the specific region of human CNN1, thus it does not cross-react with CNN2 or CNN3.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB,IF	World J Stem Cells; Bone marrow mesenchymal stem cells promote uterine healing by activating the PI3K/AKT pathway and modulating inflammation in rat models; Authors - Jing Yang
mouse	WB	Eur J Pharmacol; Exonic CircGUCY1A2 inhibits pulmonary artery smooth muscle cells phenotypic switching via regulating O-glycosylation of COL3A1 in pulmonary hypertension; Authors - June Bai