Calponin Monoclonal antibody, PBS Only (Detector)

• 

  WB analysis using 66540-1-Ig (same clone as 66540-1-PBS)

  Various tissue were subjected to SDS PAGE followed by western blot with 66540-1-Ig (Calponin antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66540-1-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA standard curve of MP50017-1

  Sandwich ELISA standard curve ofMP50017-1, Calponin Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66540-2-PBS. Detection antibody: HRP-conjugated 66540-1-PBS. Standard: Ag21384. Range: 0.313-20 ng/mL.

• 

  IHC staining of human myofibroblastoma using 66540-1-Ig (same clone as 66540-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human myofibroblastoma tissue slide using 66540-1-Ig (Calponin antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66540-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human myofibroblastoma using 66540-1-Ig (same clone as 66540-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human myofibroblastoma tissue slide using 66540-1-Ig (Calponin antibody) at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66540-1-PBS in a different storage buffer formulation.

Calponin Monoclonal Antibody for WB, IHC, Sandwich ELISA, Indirect ELISA

Cat No. 66540-1-PBS

Clone No.1A11E5

Host / Isotype

Mouse / IgG2b

Reactivity

Human

Applications

WB, IHC, Sandwich ELISA, Indirect ELISA

Synonyms

Basic calponin, Calponin, Calponin 1, Calponin H1, smooth muscle, CNN1, Sm Calp, SMCC

---

Product Information

66540-1-PBS targets Calponin as part of a matched antibody pair:

MP50017-1: 66540-2-PBS capture and 66540-1-PBS detection (validated in Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21384

  Product name: Recombinant human Calponin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 225-265 aa of BC022015

  Sequence: KRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPR

• Full Name: calponin 1, basic, smooth muscle
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 33-35 kDa
• GenBank Accession Number: BC022015
• Gene Symbol: Calponin
• Gene ID (NCBI): 1264
• RRID: AB_2881902
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P51911
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Calponin is a family of actin filament-associated proteins which regulate smooth muscle cell contraction. Three isoforms of calponin exist: calponin h1 (CNN1) , calponin h2 (CNN2) and calponin 3 (CNN3). CNN1 is a basic 34-kD protein specifically expressed in smooth muscle and a marker of smooth muscle cell differentiation. This antibody raised against the specific region of human CNN1, thus it does not cross-react with CNN2 or CNN3.