Product Information
66540-1-PBS targets Calponin as part of a matched antibody pair:
MP50017-1: 66540-2-PBS capture and 66540-1-PBS detection (validated in Sandwich ELISA)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | Human |
Host / Isotype | Mouse / IgG2b |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag21384 Product name: Recombinant human Calponin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 225-265 aa of BC022015 Sequence: KRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPR Predict reactive species |
Full Name | calponin 1, basic, smooth muscle |
Calculated Molecular Weight | 33 kDa |
Observed Molecular Weight | 33-35 kDa |
GenBank Accession Number | BC022015 |
Gene Symbol | Calponin |
Gene ID (NCBI) | 1264 |
RRID | AB_2881902 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P51911 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
Calponin is a family of actin filament-associated proteins which regulate smooth muscle cell contraction. Three isoforms of calponin exist: calponin h1 (CNN1) , calponin h2 (CNN2) and calponin 3 (CNN3). CNN1 is a basic 34-kD protein specifically expressed in smooth muscle and a marker of smooth muscle cell differentiation. This antibody raised against the specific region of human CNN1, thus it does not cross-react with CNN2 or CNN3.