Calponin Monoclonal antibody, PBS Only (Detector)

Calponin Monoclonal Antibody for WB, IHC, Sandwich ELISA, Indirect ELISA
Cat No. 66540-1-PBS
Clone No.1A11E5

Host / Isotype

Mouse / IgG2b

Reactivity

Human

Applications

WB, IHC, Sandwich ELISA, Indirect ELISA

Basic calponin, Calponin, Calponin 1, Calponin H1, smooth muscle, CNN1, Sm Calp, SMCC

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66540-1-PBS targets Calponin as part of a matched antibody pair:

MP50017-1: 66540-2-PBS capture and 66540-1-PBS detection (validated in Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity Human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag21384

Product name: Recombinant human Calponin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 225-265 aa of BC022015

Sequence: KRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPR

Predict reactive species
Full Name calponin 1, basic, smooth muscle
Calculated Molecular Weight 33 kDa
Observed Molecular Weight 33-35 kDa
GenBank Accession NumberBC022015
Gene Symbol Calponin
Gene ID (NCBI) 1264
RRIDAB_2881902
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP51911
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Calponin is a family of actin filament-associated proteins which regulate smooth muscle cell contraction. Three isoforms of calponin exist: calponin h1 (CNN1) , calponin h2 (CNN2) and calponin 3 (CNN3). CNN1 is a basic 34-kD protein specifically expressed in smooth muscle and a marker of smooth muscle cell differentiation. This antibody raised against the specific region of human CNN1, thus it does not cross-react with CNN2 or CNN3.

Loading...
||
New chat Able
正在加载,请稍候...