Tested Applications
| Positive WB detected in | mouse heart tissue | 
| Positive IHC detected in | human skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below | 
| IHC | See 1 publications below | 
Product Information
26665-1-AP targets Calsequestrin 1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse | 
| Cited Reactivity | human, mouse | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag24684 Product name: Recombinant human CASQ1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 35-91 aa of BC022289 Sequence: PEYDGVDRVINVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEMEELILELAAQ Predict reactive species | 
                                    
| Full Name | calsequestrin 1 (fast-twitch, skeletal muscle) | 
| Calculated Molecular Weight | 390 aa, 45 kDa | 
| Observed Molecular Weight | 45 kDa, 63 kDa | 
| GenBank Accession Number | BC022289 | 
| Gene Symbol | Calsequestrin 1 | 
| Gene ID (NCBI) | 844 | 
| RRID | AB_2880594 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | P31415 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for Calsequestrin 1 antibody 26665-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
J Neuropathol Exp Neurol Morphological Alterations of the Sarcotubular System in Permanent Myopathy of Hereditary Hypokalemic Periodic Paralysis with a Mutation in the CACNA1S Gene. | ||
J Muscle Res Cell Motil Differential regulation of Actn2 and Actn3 expression during unfolded protein response in C2C12 myotubes. | ||
JCI Insight Critical role of Znhit1 for postnatal heart function and vacuolar cardiomyopathy. | ||
Sci Rep ERG1A K+ channel increases intracellular calcium concentration through modulation of calsequestrin1 in C2C12 myotubes | 
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Marco (Verified Customer) (07-19-2024)  | Took the risk and tried it in neonatal rat cardiomyocytes. It worked ! 
 ![]()  | 






