Tested Applications
| Positive WB detected in | mouse heart tissue |
| Positive IHC detected in | human skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26665-1-AP targets Calsequestrin 1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24684 Product name: Recombinant human CASQ1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 35-91 aa of BC022289 Sequence: PEYDGVDRVINVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEMEELILELAAQ Predict reactive species |
| Full Name | calsequestrin 1 (fast-twitch, skeletal muscle) |
| Calculated Molecular Weight | 390 aa, 45 kDa |
| Observed Molecular Weight | 45 kDa, 63 kDa |
| GenBank Accession Number | BC022289 |
| Gene Symbol | Calsequestrin 1 |
| Gene ID (NCBI) | 844 |
| RRID | AB_2880594 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P31415 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for Calsequestrin 1 antibody 26665-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Calsequestrin 1 Polyclonal antibody (Cat# 26665-1-AP) has 5 total citations. These appear in JCI Insight, Scientific Reports, Frontiers in Molecular Biosciences, Journal of Neuropathology & Experimental Neurology, and Journal of Muscle Research and Cell Motility. The associated research fields include cardiac function and vacuolar cardiomyopathy, intracellular calcium signaling, cardiac glycosylation/aging, sarcotubular system morphology in myopathy, and actin gene regulation during the unfolded protein response. Applications cited were WB and IHC in mouse and human samples.
| Species | Application | Title |
|---|---|---|
JCI Insight Critical role of Znhit1 for postnatal heart function and vacuolar cardiomyopathy. | ||
Sci Rep ERG1A K+ channel increases intracellular calcium concentration through modulation of calsequestrin1 in C2C12 myotubes | ||
J Neuropathol Exp Neurol Morphological Alterations of the Sarcotubular System in Permanent Myopathy of Hereditary Hypokalemic Periodic Paralysis with a Mutation in the CACNA1S Gene. | ||
J Muscle Res Cell Motil Differential regulation of Actn2 and Actn3 expression during unfolded protein response in C2C12 myotubes. |
Reviews
What customers say
The single review for this product is highly positive (5 stars). The reviewer tested the antibody in Western Blot at a 1:1000 dilution using iPSC-derived and neonatal rat ventricular cardiomyocytes. They noted they "took the risk" trying it in neonatal rat cardiomyocytes and reported that it worked well. Overall, the feedback indicates reliable performance in WB applications for cardiac cell types.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Marco (Verified Customer) (07-19-2024) | Took the risk and tried it in neonatal rat cardiomyocytes. It worked !
 |
