Tested Applications
| Positive WB detected in | mouse heart tissue |
| Positive IHC detected in | human skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26665-1-AP targets Calsequestrin 1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24684 Product name: Recombinant human CASQ1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 35-91 aa of BC022289 Sequence: PEYDGVDRVINVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEMEELILELAAQ Predict reactive species |
| Full Name | calsequestrin 1 (fast-twitch, skeletal muscle) |
| Calculated Molecular Weight | 390 aa, 45 kDa |
| Observed Molecular Weight | 45 kDa, 63 kDa |
| GenBank Accession Number | BC022289 |
| Gene Symbol | Calsequestrin 1 |
| Gene ID (NCBI) | 844 |
| RRID | AB_2880594 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P31415 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for Calsequestrin 1 antibody 26665-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
J Neuropathol Exp Neurol Morphological Alterations of the Sarcotubular System in Permanent Myopathy of Hereditary Hypokalemic Periodic Paralysis with a Mutation in the CACNA1S Gene. | ||
J Muscle Res Cell Motil Differential regulation of Actn2 and Actn3 expression during unfolded protein response in C2C12 myotubes. | ||
JCI Insight Critical role of Znhit1 for postnatal heart function and vacuolar cardiomyopathy. | ||
Sci Rep ERG1A K+ channel increases intracellular calcium concentration through modulation of calsequestrin1 in C2C12 myotubes |
Reviews
What customers say
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Marco (Verified Customer) (07-19-2024) | Took the risk and tried it in neonatal rat cardiomyocytes. It worked !
![]() |






