Calsequestrin 1 Polyclonal antibody

• 

  WB analysis of mouse heart using 26665-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 26665-1-AP (Calsequestrin antibody at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human skeletal muscle tissue using 26665-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 26665-1-AP( Calsequestrin antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human skeletal muscle tissue using 26665-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 26665-1-AP( Calsequestrin antibody) at dilution of 1:200 (under 40x lens).

Calsequestrin 1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26665-1-AP

Publications(5)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

Calmitin, Calsequestrin 1, CASQ, CASQ1, PDIB1

---

Tested Applications

• Positive WB detected in: mouse heart tissue
• Positive IHC detected in: human skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• IHC: See 1 publications below

Product Information

26665-1-AP targets Calsequestrin 1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24684

  Product name: Recombinant human CASQ1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 35-91 aa of BC022289

  Sequence: PEYDGVDRVINVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEMEELILELAAQ

• Full Name: calsequestrin 1 (fast-twitch, skeletal muscle)
• Calculated Molecular Weight: 390 aa, 45 kDa
• Observed Molecular Weight: 45 kDa, 63 kDa
• GenBank Accession Number: BC022289
• Gene Symbol: Calsequestrin 1
• Gene ID (NCBI): 844
• RRID: AB_2880594
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P31415
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Front Mol Biosci; Altered Glycosylation in the Aging Heart.; Authors - Patricia Franzka
human	IHC	J Neuropathol Exp Neurol; Morphological Alterations of the Sarcotubular System in Permanent Myopathy of Hereditary Hypokalemic Periodic Paralysis with a Mutation in the CACNA1S Gene.; Authors - Takamura Nagasaka
mouse	WB	J Muscle Res Cell Motil; Differential regulation of Actn2 and Actn3 expression during unfolded protein response in C2C12 myotubes.; Authors - Nagakatsu Harada
mouse	WB	JCI Insight; Critical role of Znhit1 for postnatal heart function and vacuolar cardiomyopathy.; Authors - Yingchao Shi
mouse	WB	Sci Rep; ERG1A K+ channel increases intracellular calcium concentration through modulation of calsequestrin1 in C2C12 myotubes; Authors - Gregory H Hockerman

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Marco (Verified Customer) (07-19-2024)

Took the risk and tried it in neonatal rat cardiomyocytes. It worked !

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: iPSC, NRVCM

Calsequestrin 1 Antibody Western Blot validation (1:1000 dilution) in iPSC, NRVCM (Cat no:26665-1-AP)