Mouse Chemerin Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Mouse Chemerin Recombinant monoclonal antibody, PBS Only (83550-4-PBS)

• 

  WB analysis using 83550-4-RR (same clone as 83550-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83550-4-RR (Chemerin antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83550-4-PBS in a different storage buffer formulation.

• 

  FC experiment of C57BL/6 mouse liver cells using 83550-4-RR (same clone as 83550-4-PBS)

  1x10^6 C57BL/6 mouse liver cells were intracellularly stained with 0.25 ug Chemerin Recombinant antibody (83550-4-RR, Clone:240355A12) and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83550-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83550-4-RR

  Biolayer interferometry (BLl) kinetic assays of 83550-4-RR against Mouse Chemerin were performed. The affinity constant is 3.76 nM.

Chemerin Uni-rAb^® Recombinant Antibody for WB, FC (Intra), ELISA

Cat No. 83550-4-PBS

Clone No.240355A12

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, FC (Intra), ELISA

Synonyms

Rarres2, 240355A12, AI303516, Retinoic acid receptor responder protein 2

---

Product Information

83550-4-PBS targets Chemerin in WB, FC (Intra), ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0875

  Product name: Recombinant mouse Chemerin protein

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 21-156 aa of NM_001347168.1

  Sequence: EPELSETQRRSLQVALEEFHKHPPVQLAFQEIGVDRAEEVLFSAGTFVRLEFKLQQTNCPKKDWKKPECTIKPNGRRRKCLACIKMDPKGKILGRIVHCPILKQGPQDPQELQCIKIAQAGEDPHGYFLPGQFAFS

• Full Name: retinoic acid receptor responder (tazarotene induced) 2
• Calculated Molecular Weight: 18 kDa
• GenBank Accession Number: NM_001347168.1
• Gene Symbol: Chemerin
• Gene ID (NCBI): 71660
• RRID: AB_3671168
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9DD06
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Chemerin, also named as TIG2 and RARRES2, is adipocyte-secreted protein (adipokine) that regulates adipogenesis, metabolism and inflammation through activation of the chemokine-like receptor 1 (CMKLR1). Its other ligands include G protein-coupled receptor 1 (GPR1) and chemokine receptor-like 2 (CCRL2). It positively regulates adipocyte differentiation, modulates the expression of adipocyte genes involved in lipid and glucose metabolism and might play a role in angiogenesis, a process essential for the expansion of white adipose tissue. RARRES2 have both pro- and anti-inflammatory properties depending on the modality of enzymatic cleavage by different classes of proteases. The MW of Chemerin is 14-19 kDa.