Tested Applications
| Positive WB detected in | mouse adipose tissue, mouse brown adipose tissue |
| Positive FC (Intra) detected in | C57BL/6 mouse liver cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
83550-4-RR targets Chemerin in WB, FC (Intra), ELISA applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg0875 Product name: Recombinant mouse Chemerin protein Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 21-156 aa of NM_001347168.1 Sequence: EPELSETQRRSLQVALEEFHKHPPVQLAFQEIGVDRAEEVLFSAGTFVRLEFKLQQTNCPKKDWKKPECTIKPNGRRRKCLACIKMDPKGKILGRIVHCPILKQGPQDPQELQCIKIAQAGEDPHGYFLPGQFAFS Predict reactive species |
| Full Name | retinoic acid receptor responder (tazarotene induced) 2 |
| Calculated Molecular Weight | 18 kDa |
| Observed Molecular Weight | 14-19 kDa |
| GenBank Accession Number | NM_001347168.1 |
| Gene Symbol | Chemerin |
| Gene ID (NCBI) | 71660 |
| RRID | AB_3671168 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q9DD06 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Chemerin, also named as TIG2 and RARRES2, is adipocyte-secreted protein (adipokine) that regulates adipogenesis, metabolism and inflammation through activation of the chemokine-like receptor 1 (CMKLR1). Its other ligands include G protein-coupled receptor 1 (GPR1) and chemokine receptor-like 2 (CCRL2). It positively regulates adipocyte differentiation, modulates the expression of adipocyte genes involved in lipid and glucose metabolism and might play a role in angiogenesis, a process essential for the expansion of white adipose tissue. RARRES2 have both pro- and anti-inflammatory properties depending on the modality of enzymatic cleavage by different classes of proteases. The MW of Chemerin is 14-19 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Chemerin antibody 83550-4-RR | Download protocol |
| WB protocol for Chemerin antibody 83550-4-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





