Chromogranin B Polyclonal antibody, PBS Only

• 

  WB analysis of PC-12 using 14968-1-AP (same clone as 14968-1-PBS)

  PC-12 cells were subjected to SDS PAGE followed by western blot with 14968-1-AP (Chromogranin B antibody at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14968-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 14968-1-AP (same clone as 14968-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14968-1-AP (Chromogranin B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14968-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 14968-1-AP (same clone as 14968-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 14968-1-AP (Chromogranin B antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14968-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 14968-1-AP (same clone as 14968-1-PBS)

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 14968-1-AP (Chromogranin B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14968-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas using 14968-1-AP (same clone as 14968-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 14968-1-AP (Chromogranin B antibody at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 14968-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas using 14968-1-AP (same clone as 14968-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 14968-1-AP (Chromogranin B antibody at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 14968-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 14968-1-AP (same clone as 14968-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 14968-1-AP (Chromogranin B antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14968-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 14968-1-AP (same clone as 14968-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 14968-1-AP (Chromogranin B antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14968-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse colon using 14968-1-AP (same clone as 14968-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse colon tissue using Chromogranin B antibody (14968-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 14968-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse colon using 14968-1-AP (same clone as 14968-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse colon tissue using Chromogranin B antibody (14968-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 14968-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse colon using 14968-1-AP (same clone as 14968-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded mouse colon tissue using 14968-1-AP (Chromogranin B antibody) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 14968-1-PBS in a different storage buffer formulation.

• 

  FC experiment of PC-12 using 14968-1-AP (same clone as 14968-1-PBS)

  1X10^6 PC-12 cells were intracellularly stained with 0.4 ug Anti-Human Chromogranin B (14968-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 14968-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Chromogranin B Polyclonal Antibody for WB, IHC, IF-P, IF-Fro, FC (Intra), Indirect ELISA

Cat No. 14968-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IF-Fro, FC (Intra), Indirect ELISA

Synonyms

CgB, CHGB, SCG1, Chromogranin-B, PE-11

---

Product Information

14968-1-PBS targets Chromogranin B in WB, IHC, IF-P, IF-Fro, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6833

  Product name: Recombinant human CHGB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 328-677 aa of BC000375

  Sequence: HSTHYRASEEEPEYGEEIKGYPGVQAPEDLEWERYRGRGSEEYRAPRPQSEESWDEEDKRNYPSLELDKMAHGYGEESEEERGLEPGKGRHHRGRGGEPRAYFMSDTREEKRFLGEGHHRVQENQMDKARRHPQGAWKELDRNYLNYGEEGAPGKWQQQGDLQDTKENREEARFQDKQYSSHHTAEKRKRLGELFNPYYDPLQWKSSHFERRDNMNDNFLEGEEENELTLNEKNFFPEYNYDWWEKKPFSEDVNWGYEKRNLARVPKLDLKRQYDRVAQLDQLLHYRKKSAEFPDFYDSEEPVSTHQEAENEKDRADQTVLTEDEKKELENLAAMDLELQKIAEKFSQRG

• Full Name: chromogranin B (secretogranin 1)
• Calculated Molecular Weight: 78 kDa
• Observed Molecular Weight: 70-100 kDa
• GenBank Accession Number: BC000375
• Gene Symbol: Chromogranin B
• Gene ID (NCBI): 1114
• RRID: AB_2081138
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P05060
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Chromogranin B is also named as Secretogranin-1, SgI, CgB, CHGB and SCG1. CHGB, a secretory granule protein, inserts itself into membrane and forms a chloride-conducting channel (PMID: 30456382). Native CHGB distributes nearly equally in soluble and membrane-bound forms, and both reconstitute highly selective anion channels in membrane (PMID: 37435575). The calculated molecular weight of Chromogranin B is at 78kDa. It has been shown that CHGB has a clear degradation band at ~50 kDa (https://www.biorxiv.org/content/10.1101/2019.12.28.890053v1.full.pdf).