Tested Applications
Positive WB detected in | COLO 320 cells |
Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
IF | See 1 publications below |
Product Information
25296-1-AP targets Claudin 23 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, canine |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag18189 Product name: Recombinant human CLDN23 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 184-292 aa of BC125148 Sequence: WCDERCRRRRKGPSAGPRRSSVSTIQVEWPEPDLAPAIKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWESQDAPSCSTHPCDSSLPCDSDL Predict reactive species |
Full Name | claudin 23 |
Calculated Molecular Weight | 292 aa, 32 kDa |
Observed Molecular Weight | 32 kDa |
GenBank Accession Number | BC125148 |
Gene Symbol | Claudin 23 |
Gene ID (NCBI) | 137075 |
RRID | AB_2880013 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q96B33 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Claudin 23 (CLDN23) belongs to the large claudin family of proteins, which are tetraspan transmembrane proteins of tight junctions (PMID: 12736707; 18036336). Claudins exhibit specific patterns of expression in different tissues. Human CLDN23 mRNA was expressed in germinal center B cells, placenta, stomach as well as in colon tumor (PMID: 12736707). CLDN23 has been reported as a candidate tumor suppressor gene implicated in intestinal-type gastric cancer (PMID: 12736707).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Claudin 23 antibody 25296-1-AP | Download protocol |
IHC protocol for Claudin 23 antibody 25296-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Life Sci Microbial metabolite n-butyrate upregulates intestinal claudin-23 expression through SP1 and AMPK pathways in mouse colon and human intestinal Caco-2 cells | ||
Cell snoRNA-facilitated protein secretion revealed by transcriptome-wide snoRNA target identification |