Tested Applications
| Positive WB detected in | COLO 320 cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25296-1-AP targets Claudin 23 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, canine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18189 Product name: Recombinant human CLDN23 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 184-292 aa of BC125148 Sequence: WCDERCRRRRKGPSAGPRRSSVSTIQVEWPEPDLAPAIKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWESQDAPSCSTHPCDSSLPCDSDL Predict reactive species |
| Full Name | claudin 23 |
| Calculated Molecular Weight | 292 aa, 32 kDa |
| Observed Molecular Weight | 32 kDa |
| GenBank Accession Number | BC125148 |
| Gene Symbol | Claudin 23 |
| Gene ID (NCBI) | 137075 |
| RRID | AB_2880013 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96B33 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Claudin 23 (CLDN23) belongs to the large claudin family of proteins, which are tetraspan transmembrane proteins of tight junctions (PMID: 12736707; 18036336). Claudins exhibit specific patterns of expression in different tissues. Human CLDN23 mRNA was expressed in germinal center B cells, placenta, stomach as well as in colon tumor (PMID: 12736707). CLDN23 has been reported as a candidate tumor suppressor gene implicated in intestinal-type gastric cancer (PMID: 12736707).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Claudin 23 antibody 25296-1-AP | Download protocol |
| WB protocol for Claudin 23 antibody 25296-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Life Sci Microbial metabolite n-butyrate upregulates intestinal claudin-23 expression through SP1 and AMPK pathways in mouse colon and human intestinal Caco-2 cells | ||
Cell snoRNA-facilitated protein secretion revealed by transcriptome-wide snoRNA target identification |





