Complement factor B Polyclonal antibody, PBS Only

• 

  WB analysis using 10170-1-AP (same clone as 10170-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10170-1-AP (Complement factor B antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10170-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 10170-1-AP (same clone as 10170-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10170-1-AP (Complement factor B antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10170-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 10170-1-AP (same clone as 10170-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10170-1-AP (Complement factor B antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10170-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human blood using 10170-1-AP (same clone as 10170-1-PBS)

  human blood were subjected to SDS PAGE followed by western blot with 10170-1-AP (Complement factor B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10170-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human plasma using 10170-1-AP (same clone as 10170-1-PBS)

  human blood were subjected to SDS PAGE followed by western blot with 10170-1-AP (Complement factor B antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10170-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 10170-1-AP (same clone as 10170-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 10170-1-AP (Complement factor B antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10170-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 10170-1-AP (same clone as 10170-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 10170-1-AP (Complement factor B antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10170-1-PBS in a different storage buffer formulation.

Complement factor B Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 10170-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

CFB, Complement factor B Ba fragment, CFAB, C3/C5 convertase, BFD

---

Product Information

10170-1-PBS targets Complement factor B in WB, IHC, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0226

  Product name: Recombinant human CFB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 574-762 aa of BC007990

  Sequence: DYDVALIKLKNKLKYGQTIRPICLPCTEGTTRALRLPPTTTCQQQKEELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVVTPRFLCTGGVSPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWGVVDVCKNQKRQKQVPAHARDFHINLFQVLPWLKEKLQDEDLG

• Full Name: complement factor B
• Calculated Molecular Weight: 86 kDa
• Observed Molecular Weight: 93-100 kDa, 60-69 kDa
• GenBank Accession Number: BC007990
• Gene Symbol: Complement factor B
• Gene ID (NCBI): 629
• RRID: AB_2082384
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P00751
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Complement factor B (CFB) is a component of the alternative pathway of complement activation. Complement factor B is a 93-100 kDa glycoprotein and is cleaved into Ba (33 kDa) and Bb (60 kDa) by factor D in the presence of C3b (PMID: 11025450). The active subunit Bb is a serine protease which associates with C3b to form the alternative pathway C3 convertase. Bb is involved in the proliferation of preactivated B lymphocytes, while Ba inhibits their proliferation. This antibody raised against 573-761aa of human complement factor B can recognize complement factor B and Bb fragment.