Connexin 43 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Connexin 43 Polyclonal antibody, PBS Only (26980-1-PBS)

• 

  WB analysis using 26980-1-AP (same clone as 26980-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26980-1-AP (Connexin 43 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26980-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 26980-1-AP (same clone as 26980-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 26980-1-AP (Connexin 43 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26980-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse heart using 26980-1-AP (same clone as 26980-1-PBS)

  IP result of anti-Connexin 43 (IP:26980-1-AP, 4ug; Detection:26980-1-AP 1:500) with mouse heart tissue lysate 4000 ug. This data was developed using the same antibody clone with 26980-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat heart using 26980-1-AP (same clone as 26980-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 26980-1-AP (Connexin 43 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26980-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat heart using 26980-1-AP (same clone as 26980-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 26980-1-AP (Connexin 43 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26980-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 26980-1-AP (same clone as 26980-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 26980-1-AP (Connexin 43 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26980-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 26980-1-AP (same clone as 26980-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 26980-1-AP (Connexin 43 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 26980-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 26980-1-AP (same clone as 26980-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 26980-1-AP (Connexin 43 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 26980-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse heart using 26980-1-AP (same clone as 26980-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using 26980-1-AP (Connexin 43 antibody) at dilution of 1:50 and 66895-1-Ig (alpha Actinin mouse mAb) at dilution of 1:50, further stained with CoraLite488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) for 26980-1-AP, and CoraLite594-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) for 66895-1-Ig. This data was developed using the same antibody clone with 26980-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse heart using 26980-1-AP (same clone as 26980-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse heart tissue using Connexin 43 antibody (26980-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26980-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse heart using 26980-1-AP (same clone as 26980-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse heart tissue using Connexin 43 antibody (26980-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26980-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human heart using 26980-1-AP (same clone as 26980-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human heart tissue using 26980-1-AP (Connexin 43 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 26980-1-PBS in a different storage buffer formulation.

Connexin 43 Polyclonal Antibody for WB, IHC, IF-P, IP, Indirect ELISA

Cat No. 26980-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, Indirect ELISA

Synonyms

GJA1, Connexin-43, GJAL, Gap junction alpha-1 protein, Gap junction alpha 1 protein

---

Product Information

26980-1-PBS targets Connexin 43 in WB, IHC, IF-P, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25533

  Product name: Recombinant human Connexin 43 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 232-382 aa of BC026329

  Sequence: FFKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI

• Full Name: gap junction protein, alpha 1, 43kDa
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 43-47 kDa
• GenBank Accession Number: BC026329
• Gene Symbol: Connexin-43
• Gene ID (NCBI): 2697
• RRID: AB_2880711
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P17302
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Connexin-43 (Cx43, also known as gap junction alpha-1), a member of connexin family, plays essential roles in gap junction communication that facilitates direct communication among adjacent cells (PMID: 12270943). Usually, six connexin proteins oligomerize into a hemi-channel or connexon during intercellular channel formation (PMID: 12270943). Mutations of Cx43 may cause a series of diseases such as oculodentodigital dysplasia (ODDD), syndactyly 3 (SDTY3), hypoplastic left heart syndrome 1 (HLHS1) and so on (PMID: 18161618, 1472936, 1147490).