Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Cystatin C Recombinant monoclonal antibody

Cystatin C Uni-rAb® Recombinant Antibody for WB, IHC, ELISA

Cat No. 82441-1-RR
Clone No. 1I20
Publications (1)
Review Product
Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA
For IF, select conjugated version.

CST3, Cystatin 3, Cystatin-3, Cystatin-C, Gamma-trace

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Cystatin C in ?

Tested Applications

Positive WB detected inHepG2 cells, human milk, human urine
Positive IHC detected inhuman kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:15000
Immunohistochemistry (IHC)IHC : 1:150-1:600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82441-1-RR targets Cystatin C in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2890

Product name: Recombinant human Cystatin C protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 25-146 aa of BC013083

Sequence: AGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

Predict reactive species
Full Name cystatin C
Calculated Molecular Weight 146 aa, 16 kDa
Observed Molecular Weight 13 kDa
GenBank Accession NumberBC013083
Gene Symbol Cystatin C
Gene ID (NCBI) 1471
RRIDAB_3086479
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01034
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cystatin C is a 13-kDa inhibitor of cysteine proteinases which is secreted by all cell types and is completely cleared from the organism through glomerular filtration, shown to be an early and sensitive biomarker of renal dysfunction. It is also used as an emerging biomarker in cardiovascular disease. Cystatin C is involved in a variety of inflammatory reactions. The concentration of serum cystatin C has also been shown to be unaltered in certain inflammatory conditions or other disorders of metabolism. The plasma level of serum cystatin C can be expressed as its level of generation from cells and diet and its subsequent elimination through the gut, liver, and kidneys.

Protocols

Product Specific Protocols
IHC protocol for Cystatin C antibody 82441-1-RRDownload protocol
WB protocol for Cystatin C antibody 82441-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The Cystatin C Recombinant monoclonal antibody (1I20), catalog number 82441-1-RR, has 1 total citation. The citation appears in Virology Journal (Virol J, IF 4), published in 2025. The study investigated serotype-specific host proteome remodeling in human foreskin fibroblasts during lytic HSV-1 and HSV-2 infection, placing it within the fields of virology and infectious disease. The antibody was used for Western blot (WB) analysis in human samples.

SpeciesApplicationTitle
humanWB

Virol J

Serotype-specific host proteome remodeling in human foreskin fibroblasts during lytic HSV-1 and HSV-2 infection

Authors - Xiaohong Pan
Loading...
||
New chat

Able™

正在加载,请稍候...