• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated Cystatin C Recombinant monoclonal antibody

Cystatin C Uni-rAb® Recombinant Antibody for IF-P

Cat No. CL488-82441
Clone No.1I20

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF-P

CST3, 1I20, Cystatin 3, Cystatin-3, Cystatin-C

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse kidney tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82441 targets Cystatin C in IF-P applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2890

Product name: Recombinant human Cystatin C protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 25-146 aa of BC013083

Sequence: AGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

Predict reactive species
Full Name cystatin C
Calculated Molecular Weight 146 aa, 16 kDa
Observed Molecular Weight 13 kDa
GenBank Accession NumberBC013083
Gene Symbol Cystatin C
Gene ID (NCBI) 1471
RRIDAB_3673064
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01034
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Cystatin C is a 13-kDa inhibitor of cysteine proteinases which is secreted by all cell types and is completely cleared from the organism through glomerular filtration, shown to be an early and sensitive biomarker of renal dysfunction. It is also used as an emerging biomarker in cardiovascular disease. Cystatin C is involved in a variety of inflammatory reactions. The concentration of serum cystatin C has also been shown to be unaltered in certain inflammatory conditions or other disorders of metabolism. The plasma level of serum cystatin C can be expressed as its level of generation from cells and diet and its subsequent elimination through the gut, liver, and kidneys.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Cystatin C antibody CL488-82441Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...