Home
Products
Primary Antibodies
Cytokeratin 10 Polyclonal antibody, PBS Only (18343-1-PBS)

Filter: AllWBIHCIF-PIF/ICCFC (Intra)

WB analysis using 18343-1-AP (same clone as 18343-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 18343-1-AP (Cytokeratin 10 antibody) at dilution of 1:200000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18343-1-PBS in a different storage buffer formulation.
WB analysis of A431 using 18343-1-AP (same clone as 18343-1-PBS)
A431 cells were subjected to SDS PAGE followed by western blot with 18343-1-AP (Cytokeratin 10 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18343-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 18343-1-AP (same clone as 18343-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 18343-1-AP (Cytokeratin 10 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18343-1-PBS in a different storage buffer formulation.
IHC staining of human cervical cancer using 18343-1-AP (same clone as 18343-1-PBS)
Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 18343-1-AP (Cytokeratin 10 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18343-1-PBS in a different storage buffer formulation.
IHC staining of human cervical cancer using 18343-1-AP (same clone as 18343-1-PBS)
Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 18343-1-AP (Cytokeratin 10 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18343-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 18343-1-AP (same clone as 18343-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 18343-1-AP (Cytokeratin 10 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18343-1-PBS in a different storage buffer formulation.
IHC staining of rat skin using 18343-1-AP (same clone as 18343-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat skin tissue slide using 18343-1-AP (Cytokeratin 10 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18343-1-PBS in a different storage buffer formulation.
IHC staining of rat skin using 18343-1-AP (same clone as 18343-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat skin tissue slide using 18343-1-AP (Cytokeratin 10 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18343-1-PBS in a different storage buffer formulation.
IHC staining of human oesophagus cancer using 18343-1-PBS
Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 18343-1-AP (Cytokeratin 10 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human oesophagus cancer using 18343-1-PBS
Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 18343-1-AP (Cytokeratin 10 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human skin cancer using 18343-1-AP (same clone as 18343-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 18343-1-AP (Cytokeratin 10 antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 18343-1-PBS in a different storage buffer formulation.
IHC staining of human skin cancer using 18343-1-AP (same clone as 18343-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 18343-1-AP (Cytokeratin 10 antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 18343-1-PBS in a different storage buffer formulation.
IHC staining of human skin cancer using 18343-1-AP (same clone as 18343-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 18343-1-AP (Cytokeratin 10 antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 18343-1-PBS in a different storage buffer formulation.
IHC staining of human skin cancer using 18343-1-AP (same clone as 18343-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 18343-1-AP (Cytokeratin 10 antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 18343-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 18343-1-AP (same clone as 18343-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer using 18343-1-AP (Cytokeratin 10 antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 18343-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 18343-1-AP (same clone as 18343-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer using 18343-1-AP (Cytokeratin 10 antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 18343-1-PBS in a different storage buffer formulation.
IF Staining of mouse skin using 18343-1-AP (same clone as 18343-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse skin tissue using Cytokeratin 10 antibody (18343-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18343-1-PBS in a different storage buffer formulation.
IF Staining of mouse skin using 18343-1-AP (same clone as 18343-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse skin tissue using Cytokeratin 10 antibody (18343-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18343-1-PBS in a different storage buffer formulation.
IF Staining of mouse skin using 18343-1-AP (same clone as 18343-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse skin tissue using Cytokeratin 10 antibody (18343-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18343-1-PBS in a different storage buffer formulation.
IF Staining of A431 using 18343-1-AP (same clone as 18343-1-PBS)
Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using Cytokeratin 10 antibody (18343-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 18343-1-PBS in a different storage buffer formulation.
FC experiment of A431 using 18343-1-AP (same clone as 18343-1-PBS)
1X10^6 A431 cells were intracellularly stained with 0.4 ug Anti-Human Cytokeratin 10 (18343-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 18343-1-PBS in a different storage buffer formulation.
×
1X10^6 A431 cells were intracellularly stained with 0.4 ug Anti-Human Cytokeratin 10 (18343-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 18343-1-PBS in a different storage buffer formulation.

Cytokeratin 10 Polyclonal antibody, PBS Only

Name: Cytokeratin 10 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 18343-1-PBS

Cytokeratin 10 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

Cat No. 18343-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

Synonyms

KRT10, CK 10, CK10, CK-10, Cytokeratin-10

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

18343-1-PBS targets Cytokeratin 10 in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag13136 Product name: Recombinant human KRT10 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 235-584 aa of BC034697 Sequence: RLKYENEVALRQSVEADINGLRRVLDELTLTKADLEMQIESLTEELAYLKKNHEEEMKDLRNVSTGDVNVEMNAAPGVDLTQLLNNMRSQYEQLAEQNRKDAEAWFNEKSKELTTEIDNNIEQISSYKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCVQLSQIQAQISALEEQLQQIRAETECQNTEYQQLLDIKIRLENEIQTYRSLLEGEGSSGGGGRGGGSFGGGYGGGSSGGGSSGGGYGGGHGGSSGGGYGGGSSGGGSSGGGYGGGSSSGGHGGSSSGGYGGGSSGGGGGGYGGGSSGGGSSSGGGYGGGSSSGGHKSSSSGSVGESSSKGPRY Predict reactive species
Full Name	keratin 10
Calculated Molecular Weight	584 aa, 59 kDa
Observed Molecular Weight	50-59 kDa
GenBank Accession Number	BC034697
Gene Symbol	Cytokeratin 10
Gene ID (NCBI)	3858
RRID	AB_10863654
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P13645
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. As a type I keratin, keratin 10 is a suprabasal marker of differentiation in stratified squamous epithelia.