Cytokeratin 15 Monoclonal antibody, PBS Only (Capture)

Cytokeratin 15 Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA
Cat No. 60247-1-PBS
Clone No.6B4F8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA

KRT15, 6B4F8, CK 15, CK15, CK-15

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60247-1-PBS targets Cytokeratin 15 as part of a matched antibody pair:

MP50002-1: 60247-1-PBS capture and 60247-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0185

Product name: Recombinant human KRT15 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 238-450 aa of BC002641

Sequence: AYLKKNHEEEMKEFSSQLAGQVNVEMDAAPGVDLTRVLAEMREQYEAMAEKNRRDVEAWFFSKTEELNKEVASNTEMIQTSKTEITDLRRTMQELEIELQSQLSMKAGLENSLAETECRYATQLQQIQGLIGGLEAQLSELRCEMEAQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVEESVDGQVVS

Predict reactive species
Full Name keratin 15
Calculated Molecular Weight 49 kDa
Observed Molecular Weight 49 kDa
GenBank Accession NumberBC002641
Gene Symbol KRT15
Gene ID (NCBI) 3866
RRIDAB_2881369
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP19012
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells. Keratin expression is highly regulated, tissue specific, and varies according to cell-state. Type I keratins consist of acidic, low molecular weight proteins with MW ranging from 40 kDa (KRT19) to 64 kDa (KRT9). Type 2 keratins consist of basic or neutral, high molecular weight proteins with MW from 52 kDa (KRT8) to 67 kDa (KRT18). Keratin 15 is a type I cytokeratin. It is found in some progenitor basal cells within complex epithelia.

Loading...
||
New chat

Able

正在加载,请稍候...