DBI Polyclonal antibody, PBS Only

• 

  WB analysis using 14490-1-AP (same clone as 14490-1-PBS)

  U-87 MG cells were subjected to SDS PAGE followed by western blot with 14490-1-AP (DBI antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14490-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human liver using 14490-1-AP (same clone as 14490-1-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 14490-1-AP (DBI antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14490-1-PBS in a different storage buffer formulation.

DBI Polyclonal Antibody for WB, Indirect ELISA

Cat No. 14490-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

14490-1-PBS targets DBI in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5891

  Product name: Recombinant human DBI protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-102 aa of BC062996

  Sequence: MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKY

• Full Name: diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein)
• Calculated Molecular Weight: 10 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC062996
• Gene Symbol: ACBP/DBI
• Gene ID (NCBI): 1622
• RRID: AB_2211037
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P07108
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.