DBI Polyclonal antibody

• 

  WB analysis using 14490-1-AP

  U-87 MG cells were subjected to SDS PAGE followed by western blot with 14490-1-AP (DBI antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human liver using 14490-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 14490-1-AP (DBI antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

DBI Polyclonal Antibody for WB, ELISA

Cat No. 14490-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

ACBD1, ACBP, Acyl CoA binding protein, CCK RP, DBI, Diazepam binding inhibitor, Endozepine, EP

---

Tested Applications

• Positive WB detected in: U-87 MG cells, human liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:300-1:600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

14490-1-AP targets DBI in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5891

  Product name: Recombinant human DBI protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-102 aa of BC062996

  Sequence: MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKY

• Full Name: diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein)
• Calculated Molecular Weight: 10 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC062996
• Gene Symbol: ACBP/DBI
• Gene ID (NCBI): 1622
• RRID: AB_2211037
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P07108
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse		Sci Rep; Thioesterase induction by 2,3,7,8-tetrachlorodibenzo-p-dioxin results in a futile cycle that inhibits hepatic β-oxidation.; Authors - Giovan N Cholico
mouse	WB	Eur Neuropsychopharmacol; Deficiency of prolyl oligopeptidase in mice disturbs synaptic plasticity and reduces anxiety-like behaviour, body weight, and brain volume.; Authors - Corinna Höfling
human,mouse	WB	Hum Reprod; Palmitic acid impairs human and mouse placental function by inhibiting trophoblast autophagy through induction of acyl-coenzyme A-binding protein (ACBP) upregulation; Authors - Yi Zhang