DCLK1 Monoclonal antibody, PBS Only

• 

  WB analysis using 68234-1-Ig (same clone as 68234-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68234-1-Ig (DCLK1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68234-1-PBS in a different storage buffer formulation.

• 

  WB analysis of fetal human brain using 68234-1-Ig (same clone as 68234-1-PBS)

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 68234-1-Ig (DCLK1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68234-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 68234-1-Ig (same clone as 68234-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68234-1-Ig (DCLK1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68234-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 68234-1-Ig (same clone as 68234-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68234-1-Ig (DCLK1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68234-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 68234-1-Ig (same clone as 68234-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using DCLK1 antibody (68234-1-Ig, Clone: 3C12C1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68234-1-PBS in a different storage buffer formulation.

• 

  FC experiment of Neuro-2a using 68234-1-Ig (same clone as 68234-1-PBS)

  1X10^6 Neuro-2a cells were intracellularly stained with 0.4 ug Anti-Human DCLK1 (68234-1-Ig, Clone:3C12C1) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 68234-1-PBS in a different storage buffer formulation.

DCLK1 Monoclonal Antibody for WB, IHC, IF-P, FC (Intra), Indirect ELISA

Cat No. 68234-1-PBS

Clone No.3C12C1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF-P, FC (Intra), Indirect ELISA

Synonyms

3C12C1, DCAMKL1, DCDC3A, Doublecortin domain-containing protein 3A, Doublecortin-like and CAM kinase-like 1

---

Product Information

68234-1-PBS targets DCLK1 in WB, IHC, IF-P, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17110

  Product name: Recombinant human DCLK1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 623-729 aa of BC152456

  Sequence: LITMMLLVDVDQRFSAVQVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIALDHGFTIKRSGSLDYYQQPGMYWIRPPLLIRRGRFSDEDATRM

• Full Name: doublecortin-like kinase 1
• Calculated Molecular Weight: 729 aa, 81 kDa
• Observed Molecular Weight: 46 kDa, 82 kDa
• GenBank Accession Number: BC152456
• Gene Symbol: DCLK1
• Gene ID (NCBI): 9201
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O15075
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DCLK1 (Serine/threonine-protein kinase DCLK1) is also named as DCAMKL1, DCDC3A, KIAA0369 and belongs to the CAMK Ser/Thr protein kinase family. It is a microtubule-associated kinase that can undergo autophosphorylation and it also has microtubule-polymerizing activity that is independent of its protein kinase activity (PMID: 11124993). It plays a unique role in mitotic spindle integrity during early neurogenesis in radial glial cell proliferation and their radial process stability. DCLK1 is a unique marker for distinguishing tumor stem cells from intestinal normal stem cells (PMID: 23202126). This protein has 4 isoforms produced by alternative splicing with the molecular weight of 82 kDa, 81 kDa, 47 kDa and 48 kDa.