DCLK1 Monoclonal antibody, PBS Only

DCLK1 Monoclonal Antibody for WB, IHC, IF-P, FC (Intra), Indirect ELISA
Cat No. 68234-1-PBS
Clone No.3C12C1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF-P, FC (Intra), Indirect ELISA

3C12C1, DCAMKL1, DCDC3A, Doublecortin domain-containing protein 3A, Doublecortin-like and CAM kinase-like 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68234-1-PBS targets DCLK1 in WB, IHC, IF-P, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17110

Product name: Recombinant human DCLK1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 623-729 aa of BC152456

Sequence: LITMMLLVDVDQRFSAVQVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIALDHGFTIKRSGSLDYYQQPGMYWIRPPLLIRRGRFSDEDATRM

Predict reactive species
Full Name doublecortin-like kinase 1
Calculated Molecular Weight 729 aa, 81 kDa
Observed Molecular Weight46 kDa, 82 kDa
GenBank Accession NumberBC152456
Gene Symbol DCLK1
Gene ID (NCBI) 9201
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO15075
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

DCLK1 (Serine/threonine-protein kinase DCLK1) is also named as DCAMKL1, DCDC3A, KIAA0369 and belongs to the CAMK Ser/Thr protein kinase family. It is a microtubule-associated kinase that can undergo autophosphorylation and it also has microtubule-polymerizing activity that is independent of its protein kinase activity (PMID: 11124993). It plays a unique role in mitotic spindle integrity during early neurogenesis in radial glial cell proliferation and their radial process stability. DCLK1 is a unique marker for distinguishing tumor stem cells from intestinal normal stem cells (PMID: 23202126). This protein has 4 isoforms produced by alternative splicing with the molecular weight of 82 kDa, 81 kDa, 47 kDa and 48 kDa.

Loading...
||
New chat Able
正在加载,请稍候...