DCLK1 Monoclonal antibody

DCLK1 Monoclonal Antibody for WB, IHC, IF-P, FC (Intra), ELISA
Cat No. 68234-1-Ig
Clone No.3C12C1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF-P, FC (Intra), ELISA

3C12C1, DCAMKL1, DCDC3A, Doublecortin domain-containing protein 3A, Doublecortin-like and CAM kinase-like 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inpig brain tissue, fetal human brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue
Positive FC (Intra) detected inNeuro-2a cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68234-1-Ig targets DCLK1 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Cited Reactivitymouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17110

Product name: Recombinant human DCLK1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 623-729 aa of BC152456

Sequence: LITMMLLVDVDQRFSAVQVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIALDHGFTIKRSGSLDYYQQPGMYWIRPPLLIRRGRFSDEDATRM

Predict reactive species
Full Name doublecortin-like kinase 1
Calculated Molecular Weight 729 aa, 81 kDa
Observed Molecular Weight46 kDa, 82 kDa
GenBank Accession NumberBC152456
Gene Symbol DCLK1
Gene ID (NCBI) 9201
RRIDAB_2935321
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO15075
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DCLK1 (Serine/threonine-protein kinase DCLK1) is also named as DCAMKL1, DCDC3A, KIAA0369 and belongs to the CAMK Ser/Thr protein kinase family. It is a microtubule-associated kinase that can undergo autophosphorylation and it also has microtubule-polymerizing activity that is independent of its protein kinase activity (PMID: 11124993). It plays a unique role in mitotic spindle integrity during early neurogenesis in radial glial cell proliferation and their radial process stability. DCLK1 is a unique marker for distinguishing tumor stem cells from intestinal normal stem cells (PMID: 23202126). This protein has 4 isoforms produced by alternative splicing with the molecular weight of 82 kDa, 81 kDa, 47 kDa and 48 kDa.

Protocols

Product Specific Protocols
FC protocol for DCLK1 antibody 68234-1-IgDownload protocol
IF protocol for DCLK1 antibody 68234-1-IgDownload protocol
IHC protocol for DCLK1 antibody 68234-1-IgDownload protocol
WB protocol for DCLK1 antibody 68234-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIHC,IF

BMC Biol

Berberine ameliorates dextran sulfate sodium -induced colitis through tuft cells and bitter taste signalling

Authors - Yuxuan Yang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Cerys (Verified Customer) (08-14-2024)

Very easy to use and gives a clear signal.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1 in 500
  • Cell Tissue Type: Murine Small Intestine, 1%PFA, OCT
DCLK1 Antibody Immunohistochemistry validation (1 in 500 dilution) in Murine Small Intestine, 1%PFA, OCT (Cat no:68234-1-Ig)
Loading...
||
New chat Able
正在加载,请稍候...