DCLK1 Monoclonal antibody

• 

  WB analysis using 68234-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68234-1-Ig (DCLK1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  WB analysis of fetal human brain using 68234-1-Ig

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 68234-1-Ig (DCLK1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  IHC staining of mouse brain using 68234-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68234-1-Ig (DCLK1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 68234-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68234-1-Ig (DCLK1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brain using 68234-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using DCLK1 antibody (68234-1-Ig, Clone: 3C12C1 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

• 

  FC experiment of Neuro-2a using 68234-1-Ig

  1X10^6 Neuro-2a cells were intracellularly stained with 0.4 ug Anti-Human DCLK1 (68234-1-Ig, Clone:3C12C1) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

DCLK1 Monoclonal Antibody for WB, IHC, IF-P, FC (Intra), ELISA

Cat No. 68234-1-Ig

Clone No.3C12C1

Publications(1)

Reviews (1)

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat, rabbit, pig

Applications

WB, IHC, IF-P, FC (Intra), ELISA

Synonyms

Doublecortin-like kinase 1, Doublecortin-like and CAM kinase-like 1, Doublecortin domain-containing protein 3A, DCDC3A, DCAMKL1

---

Tested Applications

• Positive WB detected in: pig brain tissue, fetal human brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue
• Positive FC (Intra) detected in: Neuro-2a cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

68234-1-Ig targets DCLK1 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with Human, mouse, rat, rabbit, pig samples.

• Tested Reactivity: Human, mouse, rat, rabbit, pig
• Cited Reactivity: mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17110

  Product name: Recombinant human DCLK1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 623-729 aa of BC152456

  Sequence: LITMMLLVDVDQRFSAVQVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIALDHGFTIKRSGSLDYYQQPGMYWIRPPLLIRRGRFSDEDATRM

• Full Name: doublecortin-like kinase 1
• Calculated Molecular Weight: 729 aa, 81 kDa
• Observed Molecular Weight: 46 kDa, 82 kDa
• GenBank Accession Number: BC152456
• Gene Symbol: DCLK1
• Gene ID (NCBI): 9201
• RRID: AB_2935321
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O15075
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DCLK1 (Serine/threonine-protein kinase DCLK1) is also named as DCAMKL1, DCDC3A, KIAA0369 and belongs to the CAMK Ser/Thr protein kinase family. It is a microtubule-associated kinase that can undergo autophosphorylation and it also has microtubule-polymerizing activity that is independent of its protein kinase activity (PMID: 11124993). It plays a unique role in mitotic spindle integrity during early neurogenesis in radial glial cell proliferation and their radial process stability. DCLK1 is a unique marker for distinguishing tumor stem cells from intestinal normal stem cells (PMID: 23202126). This protein has 4 isoforms produced by alternative splicing with the molecular weight of 82 kDa, 81 kDa, 47 kDa and 48 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC,IF	BMC Biol; Berberine ameliorates dextran sulfate sodium -induced colitis through tuft cells and bitter taste signalling; Authors - Yuxuan Yang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Cerys (Verified Customer) (08-14-2024)

Very easy to use and gives a clear signal.

• Applications: Immunohistochemistry
• Primary Antibody Dilution: 1 in 500
• Cell Tissue Type: Murine Small Intestine, 1%PFA, OCT

DCLK1 Antibody Immunohistochemistry validation (1 in 500 dilution) in Murine Small Intestine, 1%PFA, OCT (Cat no:68234-1-Ig)