DDIT4L Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of mouse ovary using 87486-1-RR (same clone as 87486-1-PBS)

  mouse ovary tissue were subjected to SDS PAGE followed by western blot with 87486-1-RR (DDIT4L antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87486-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 87486-1-RR (same clone as 87486-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87486-1-RR (DDIT4L antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87486-1-PBS in a different storage buffer formulation.

• 

  Affinity of 87486-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87486-1-RR against Human DDIT4L were performed. The affinity constant is 1.09 nM.

DDIT4L Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87486-1-PBS

Clone No.252832G4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

DNA damage-inducible transcript 4-like protein, HIF-1 responsive protein RTP801-like, REDD2, REDD-2, RTP801L

---

Product Information

87486-1-PBS targets DDIT4L in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag29616

  Product name: Recombinant human DDIT4L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-99 aa of BC013592

  Sequence: MVATGSLSSKNPASISELLDCGYHPESLLSDFDYWDYVVPEPNLNEVIFEESTCQNLVKMLENCLSKSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTE

• Full Name: DNA-damage-inducible transcript 4-like
• Calculated Molecular Weight: 193 aa, 22 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC013592
• Gene Symbol: DDIT4L
• Gene ID (NCBI): 115265
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96D03
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DNA-damage-inducible transcript 4-like protein(DDIT4L), encoded by the stress responsive gene REDD2, is a negative regulator of mTOR signaling, and expressed predominantly in skeletal muscle. It regulates the TOR signaling pathway upstream of the TSC1-TSC2 complex and downstream of AKT1. Also, DDIT4L involves in oxidized low-density lipoprotein-induced macrophage death sensitivity.