Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HL-60 cells, THP-1 cells | 
| Positive IHC detected in | human colon cancer tissue, human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive IF/ICC detected in | HepG2 cells | 
| Positive FC (Intra) detected in | HepG2 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 | 
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 | 
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below | 
| IHC | See 1 publications below | 
| IP | See 1 publications below | 
Product Information
66925-1-Ig targets DDX21 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human | 
| Cited Reactivity | human | 
| Host / Isotype | Mouse / IgG1 | 
| Class | Monoclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag17850 Product name: Recombinant human DDX21 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 620-783 aa of BC008071 Sequence: GATSVDQRSLINSNVGFVTMILQCSIEMPNISYAWKELKEQLGEEIDSKVKGMVFLKGKLGVCFDVPTASVTEIQEKWHDSRRWQLSVATEQPELEGPREGYGGFRGQREGSRGFRGQRDGNRRFRGQREGSRGPRGQRSGGGNKSNRSQNKGQKRSFSKAFGQ Predict reactive species | 
                                    
| Full Name | DEAD (Asp-Glu-Ala-Asp) box polypeptide 21 | 
| Calculated Molecular Weight | 783 aa, 87 kDa | 
| Observed Molecular Weight | 90-95 kDa | 
| GenBank Accession Number | BC008071 | 
| Gene Symbol | DDX21 | 
| Gene ID (NCBI) | 9188 | 
| RRID | AB_2882252 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Protein G purification | 
| UNIPROT ID | Q9NR30 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
DDX21 protein belongs to DEAD box protein family which is characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD). As a putative RNA helicase, DDX21 unwinds double-stranded RNA, folds single-stranded RNA and is involved in process including ribosomal RNA biogeneis, RNA editing and general transcription. Interaction of DDX21 and c-Jun was reported in ribosomal RNA processing.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for DDX21 antibody 66925-1-Ig | Download protocol | 
| IHC protocol for DDX21 antibody 66925-1-Ig | Download protocol | 
| WB protocol for DDX21 antibody 66925-1-Ig | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Cell Death Dis TRIP13 regulates progression of gastric cancer through stabilising the expression of DDX21 | ||
Nat Commun Virus-modified paraspeckle-like condensates are hubs for viral RNA processing and their formation drives genomic instability | 















