DDX21 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• DDX21 Monoclonal antibody (66925-1-Ig)

DDX21 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 66925-1-Ig

Clone No.1B9C8

Publications(2)

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

1B9C8, DEAD box protein 21, DExD-box helicase 21, EC:3.6.4.13, Gu alpha

• 

  WB analysis using 66925-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66925-1-Ig (DDX21 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 66925-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66925-1-Ig (DDX21 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 66925-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66925-1-Ig (DDX21 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 66925-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 66925-1-Ig (DDX21 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 66925-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 66925-1-Ig (DDX21 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 66925-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66925-1-Ig (DDX21 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 66925-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using DDX21 antibody (66925-1-Ig, Clone: 1B9C8 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HepG2 using 66925-1-Ig

  1X10^6 HepG2 cells were intracellularly stained with 0.2 ug Anti-Human DDX21 (66925-1-Ig, Clone:1B9C8) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.2 ug Mouse IgG1 Isotype Control (66360-1-Ig, Clone: T1F8D3F10) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HL-60 cells, THP-1 cells
• Positive IHC detected in: human colon cancer tissue, human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66925-1-Ig targets DDX21 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17850

  Product name: Recombinant human DDX21 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 620-783 aa of BC008071

  Sequence: GATSVDQRSLINSNVGFVTMILQCSIEMPNISYAWKELKEQLGEEIDSKVKGMVFLKGKLGVCFDVPTASVTEIQEKWHDSRRWQLSVATEQPELEGPREGYGGFRGQREGSRGFRGQRDGNRRFRGQREGSRGPRGQRSGGGNKSNRSQNKGQKRSFSKAFGQ

• Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 21
• Calculated Molecular Weight: 783 aa, 87 kDa
• Observed Molecular Weight: 90-95 kDa
• GenBank Accession Number: BC008071
• Gene Symbol: DDX21
• Gene ID (NCBI): 9188
• RRID: AB_2882252
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9NR30
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DDX21 protein belongs to DEAD box protein family which is characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD). As a putative RNA helicase, DDX21 unwinds double-stranded RNA, folds single-stranded RNA and is involved in process including ribosomal RNA biogeneis, RNA editing and general transcription. Interaction of DDX21 and c-Jun was reported in ribosomal RNA processing.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IP,IHC	Cell Death Dis; TRIP13 regulates progression of gastric cancer through stabilising the expression of DDX21; Authors - Guanghui Zhang
human		Nat Commun; Virus-modified paraspeckle-like condensates are hubs for viral RNA processing and their formation drives genomic instability; Authors - Katherine L Harper