CoraLite®594-conjugated DDX21 Monoclonal antibody

• 

  IF Staining of HepG2 using CL594-66925

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite®594-conjugated DDX21 antibody (CL594-66925, Clone: 1B9C8 ) at dilution of 1:100.

• 

  FC experiment of HepG2 using CL594-66925

  1X10^6 HepG2 cells were intracellularly stained with 0.2 ug CoraLite®594 Anti-Human DDX21 (CL594-66925, Clone:1B9C8) (red), or 0.2 ug Mouse IgG1 Isotype Control (CL594-66360, Clone: T1F8D3F10) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

DDX21 Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL594-66925

Clone No.1B9C8

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC, FC (Intra)

Synonyms

GUA, Gu alpha, EC:3.6.4.13, DExD-box helicase 21, DEAD box protein 21

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66925 targets DDX21 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17850

  Product name: Recombinant human DDX21 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 620-783 aa of BC008071

  Sequence: GATSVDQRSLINSNVGFVTMILQCSIEMPNISYAWKELKEQLGEEIDSKVKGMVFLKGKLGVCFDVPTASVTEIQEKWHDSRRWQLSVATEQPELEGPREGYGGFRGQREGSRGFRGQRDGNRRFRGQREGSRGPRGQRSGGGNKSNRSQNKGQKRSFSKAFGQ

• Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 21
• Calculated Molecular Weight: 783 aa, 87 kDa
• GenBank Accession Number: BC008071
• Gene Symbol: DDX21
• Gene ID (NCBI): 9188
• RRID: AB_2920058
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9NR30
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

DDX21 protein belongs to DEAD box protein family which is characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD). As a putative RNA helicase, DDX21 unwinds double-stranded RNA, folds single-stranded RNA and is involved in process including ribosomal RNA biogeneis, RNA editing and general transcription. Interaction of DDX21 and c-Jun was reported in ribosomal RNA processing.