• Featured Product
  • KD/KO Validated

DDX21 Recombinant monoclonal antibody

DDX21 Uni-rAb® Recombinant Antibody for WB, IF/ICC, ELISA
Cat No. 80932-1-RR
Clone No.5E7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

5E7, DEAD box protein 21, DExD-box helicase 21, EC:3.6.4.13, Gu alpha

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, HepG2 cells, THP-1 cells, Jurkat cells, K-562 cells, HL-60 cells
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

80932-1-RR targets DDX21 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0804

Product name: Recombinant human DDX21 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-180 aa of BC008071

Sequence: MPGKLRSDAGLESDTAMKKGETLRKQTEEKEKKEKPKSDKTEEIAEEEETVFPKAKQVKKKAEPSEVDMNSPKSKKAKKKEEPSQNDISPKTKSLRKKKEPIEKKVVSSKTKKVTKNEEPSEEEIDAPKPKKMKKEKEMNGETREKSPKLKNGFPHPEPDCNPSEAASEESNSEIEQEIP

Predict reactive species
Full Name DEAD (Asp-Glu-Ala-Asp) box polypeptide 21
Calculated Molecular Weight 87 kDa
Observed Molecular Weight 87 kDa
GenBank Accession NumberBC008071
Gene Symbol DDX21
Gene ID (NCBI) 9188
RRIDAB_2918920
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NR30
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DDX21 protein belongs to DEAD box protein family which is characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD). As a putative RNA helicase, DDX21 unwinds double-stranded RNA, folds single-stranded RNA and is involved in process including ribosomal RNA biogeneis, RNA editing and general transcription. Interaction of DDX21 and c-Jun was reported in ribosomal RNA processing. DDX21 exists as two isoforms, molecular weight of modified isoform one is about 87 -100 kDa, and the post-modified isoform is about 75-85 kDa.

Protocols

Product Specific Protocols
IF protocol for DDX21 antibody 80932-1-RRDownload protocol
WB protocol for DDX21 antibody 80932-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...