DDX21 Recombinant monoclonal antibody

• 

  WB analysis using 80932-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 80932-1-RR (DDX21 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 80932-1-RR

  WB result of DDX21 antibody (80932-1-RR; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DDX21 transfected HeLa cells.

• 

  IF Staining of HepG2 using 80932-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using DDX21 antibody (80932-1-RR, Clone: 5E7 ) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

• 

  IF Staining of HepG2 using 80932-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using DDX21 antibody (80932-1-RR, Clone: 5E7 ) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  Affinity and Kinetic Characterization of 80932-1-RR

  Biolayer interferometry (BLl) kinetic assays of 80932-1-RR against Human DDX21 were performed. The affinity constant is 77.7 nM.

• Featured Product
• KD/KO Validated

DDX21 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 80932-1-RR

Clone No.5E7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

5E7, DEAD box protein 21, DExD-box helicase 21, EC:3.6.4.13, Gu alpha

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, THP-1 cells, Jurkat cells, K-562 cells, HL-60 cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

80932-1-RR targets DDX21 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0804

  Product name: Recombinant human DDX21 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-180 aa of BC008071

  Sequence: MPGKLRSDAGLESDTAMKKGETLRKQTEEKEKKEKPKSDKTEEIAEEEETVFPKAKQVKKKAEPSEVDMNSPKSKKAKKKEEPSQNDISPKTKSLRKKKEPIEKKVVSSKTKKVTKNEEPSEEEIDAPKPKKMKKEKEMNGETREKSPKLKNGFPHPEPDCNPSEAASEESNSEIEQEIP

• Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 21
• Calculated Molecular Weight: 87 kDa
• Observed Molecular Weight: 87 kDa
• GenBank Accession Number: BC008071
• Gene Symbol: DDX21
• Gene ID (NCBI): 9188
• RRID: AB_2918920
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NR30
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DDX21 protein belongs to DEAD box protein family which is characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD). As a putative RNA helicase, DDX21 unwinds double-stranded RNA, folds single-stranded RNA and is involved in process including ribosomal RNA biogeneis, RNA editing and general transcription. Interaction of DDX21 and c-Jun was reported in ribosomal RNA processing. DDX21 exists as two isoforms, molecular weight of modified isoform one is about 87 -100 kDa, and the post-modified isoform is about 75-85 kDa.