DDX54 Monoclonal antibody, PBS Only

• 

  WB analysis using 66664-1-Ig (same clone as 66664-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66664-1-Ig (DDX54 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Lamin B1 Monoclonal antibody (HRP-66095) as loading control. This data was developed using the same antibody clone with 66664-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66664-1-Ig (same clone as 66664-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66664-1-Ig (DDX54 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66664-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 66664-1-Ig (same clone as 66664-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed PC-3 cells using DDX54 antibody (66664-1-Ig, Clone: 1H9F4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 66664-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 66664-1-Ig (same clone as 66664-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed PC-3 cells using DDX54 antibody (66664-1-Ig, Clone: 1H9F4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 66664-1-PBS in a different storage buffer formulation.

• 

  FC experiment of PC-3 using 66664-1-Ig (same clone as 66664-1-PBS)

  1X10^6 PC-3 cells were intracellularly stained with 0.4 ug Anti-Human DDX54 (66664-1-Ig, Clone:1H9F4) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2a Isotype Control (C1.18.4) (65208-1-Ig, Clone: C1.18.4) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 66664-1-PBS in a different storage buffer formulation.

DDX54 Monoclonal Antibody for WB, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 66664-1-PBS

Clone No.1H9F4

Host / Isotype

Mouse / IgG2a

Reactivity

mouse, human

Applications

WB, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

EC:3.6.4.13, DP97, DDX 54, ATP-dependent RNA helicase DP97, ATP-dependent RNA helicase DDX54

---

Product Information

66664-1-PBS targets DDX54 in WB, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with mouse, human samples.

• Tested Reactivity: mouse, human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25289

  Product name: Recombinant human DDX54 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 778-881 aa of BC156669

  Sequence: DDRDSDEEGASDRRGPERRGGKRDRGQGASRPHAPGTPAGRVRPELKTKQQILKQRRRAQKLHFLQRGGLKQLSARNRRRVQELQQGAFGRGARSKKGKMRKRM

• Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 54
• Calculated Molecular Weight: 98 kDa
• Observed Molecular Weight: 98 kDa
• GenBank Accession Number: BC156669
• Gene Symbol: DDX54
• Gene ID (NCBI): 79039
• RRID: AB_2882019
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8TDD1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DDX54, also named as ATP-dependent RNA helicase DDX54, is a 881 amino acid protein, which contains 1 helicase ATP-binding domain and belongs to the DEAD box helicase family. DDX54/DBP10 subfamily. DDX54 localizes in nucleus and Interacts in a hormone-dependent manner with nuclear receptors. DDX54 has RNA-dependent ATPase activity and represses the transcriptional activity of nuclear receptors.