Product Information
66664-1-PBS targets DDX54 in WB, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with mouse, human samples.
Tested Reactivity | mouse, human |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25289 Product name: Recombinant human DDX54 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 778-881 aa of BC156669 Sequence: DDRDSDEEGASDRRGPERRGGKRDRGQGASRPHAPGTPAGRVRPELKTKQQILKQRRRAQKLHFLQRGGLKQLSARNRRRVQELQQGAFGRGARSKKGKMRKRM Predict reactive species |
Full Name | DEAD (Asp-Glu-Ala-Asp) box polypeptide 54 |
Calculated Molecular Weight | 98 kDa |
Observed Molecular Weight | 98 kDa |
GenBank Accession Number | BC156669 |
Gene Symbol | DDX54 |
Gene ID (NCBI) | 79039 |
RRID | AB_2882019 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q8TDD1 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
DDX54, also named as ATP-dependent RNA helicase DDX54, is a 881 amino acid protein, which contains 1 helicase ATP-binding domain and belongs to the DEAD box helicase family. DDX54/DBP10 subfamily. DDX54 localizes in nucleus and Interacts in a hormone-dependent manner with nuclear receptors. DDX54 has RNA-dependent ATPase activity and represses the transcriptional activity of nuclear receptors.