DDX54 Monoclonal antibody

• 

  WB analysis using 66664-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66664-1-Ig (DDX54 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Lamin B1 Monoclonal antibody (HRP-66095) as loading control.

• 

  WB analysis using 66664-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66664-1-Ig (DDX54 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of PC-3 using 66664-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed PC-3 cells using DDX54 antibody (66664-1-Ig, Clone: 1H9F4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

• 

  IF Staining of PC-3 using 66664-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed PC-3 cells using DDX54 antibody (66664-1-Ig, Clone: 1H9F4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

• 

  FC experiment of PC-3 using 66664-1-Ig

  1X10^6 PC-3 cells were intracellularly stained with 0.4 ug Anti-Human DDX54 (66664-1-Ig, Clone:1H9F4) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2a Isotype Control (C1.18.4) (65208-1-Ig, Clone: C1.18.4) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

DDX54 Monoclonal Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 66664-1-Ig

Clone No.1H9F4

Publications(1)

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

EC:3.6.4.13, DP97, DDX 54, ATP-dependent RNA helicase DP97, ATP-dependent RNA helicase DDX54

---

Tested Applications

• Positive WB detected in: HepG2 cells, LNCaP cells, HeLa cells, Jurkat cells, K-562 cells, PC-3 cells, U-251 cells, U-87 MG cells
• Positive IF/ICC detected in: PC-3 cells
• Positive FC (Intra) detected in: PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

66664-1-Ig targets DDX54 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25289

  Product name: Recombinant human DDX54 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 778-881 aa of BC156669

  Sequence: DDRDSDEEGASDRRGPERRGGKRDRGQGASRPHAPGTPAGRVRPELKTKQQILKQRRRAQKLHFLQRGGLKQLSARNRRRVQELQQGAFGRGARSKKGKMRKRM

• Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 54
• Calculated Molecular Weight: 98 kDa
• Observed Molecular Weight: 98 kDa
• GenBank Accession Number: BC156669
• Gene Symbol: DDX54
• Gene ID (NCBI): 79039
• RRID: AB_2882019
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8TDD1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DDX54, also named as ATP-dependent RNA helicase DDX54, is a 881 amino acid protein, which contains 1 helicase ATP-binding domain and belongs to the DEAD box helicase family. DDX54/DBP10 subfamily. DDX54 localizes in nucleus and Interacts in a hormone-dependent manner with nuclear receptors. DDX54 has RNA-dependent ATPase activity and represses the transcriptional activity of nuclear receptors.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Front Oncol; DDX54 Plays a Cancerous Role Through Activating P65 and AKT Signaling Pathway in Colorectal Cancer.; Authors - Yi Yu