DDX60 Recombinant monoclonal antibody

DDX60 Uni-rAb® Recombinant Antibody for IHC, IF-P, FC (Intra), ELISA
Cat No. 82969-4-RR
Clone No.230293G10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF-P, FC (Intra), ELISA

230293G10, DEAD box protein 60, EC:3.6.4.13, Probable ATP-dependent RNA helicase DDX60

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman stomach tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman stomach tissue
Positive FC (Intra) detected inA431 cells

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)-PIF-P : 1:500-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82969-4-RR targets DDX60 in IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34406

Product name: Recombinant human DDX60 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1135-1250 aa of BC038115

Sequence: KLGAVENAAESVSTFLKKKQETKRPPKADKEAHVMANKLRKVKKSIEKQKIIDEKSQKKTRNVDQSLIHEAEHDNLVKCLEKNLEIPQDCTYADQKAVDTETLQKVFGRVKFERKG

Predict reactive species
Full Name DEAD (Asp-Glu-Ala-Asp) box polypeptide 60
Calculated Molecular Weight 1712 aa, 198 kDa
Observed Molecular Weight 170-200 kDa
GenBank Accession NumberBC038115
Gene Symbol DDX60
Gene ID (NCBI) 55601
RRIDAB_3670717
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8IY21
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DDX60, also called FLJ20035, is an IFN-inducible gene that has been identified via a microarray analysis of genes induced by viral infection in human dendritic cells (DCs). DDX60 expression correlated strongly with immune checkpoint and immune system-related metagene clusters, and DDX60 promoted cell proliferation, migration, and invasion and was related to poor prognosis and immune resistance(PMID: 37274827). Involved in RIG-I-dependent and independent innate immune responses, DDX60 has been proven to be associated with the development of tumors.

Protocols

Product Specific Protocols
FC protocol for DDX60 antibody 82969-4-RRDownload protocol
IF protocol for DDX60 antibody 82969-4-RRDownload protocol
IHC protocol for DDX60 antibody 82969-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...