Tested Applications
Positive IHC detected in | human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | human stomach tissue |
Positive FC (Intra) detected in | A431 cells |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
Immunofluorescence (IF)-P | IF-P : 1:500-1:2000 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
82969-4-RR targets DDX60 in IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag34406 Product name: Recombinant human DDX60 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1135-1250 aa of BC038115 Sequence: KLGAVENAAESVSTFLKKKQETKRPPKADKEAHVMANKLRKVKKSIEKQKIIDEKSQKKTRNVDQSLIHEAEHDNLVKCLEKNLEIPQDCTYADQKAVDTETLQKVFGRVKFERKG Predict reactive species |
Full Name | DEAD (Asp-Glu-Ala-Asp) box polypeptide 60 |
Calculated Molecular Weight | 1712 aa, 198 kDa |
Observed Molecular Weight | 170-200 kDa |
GenBank Accession Number | BC038115 |
Gene Symbol | DDX60 |
Gene ID (NCBI) | 55601 |
RRID | AB_3670717 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q8IY21 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DDX60, also called FLJ20035, is an IFN-inducible gene that has been identified via a microarray analysis of genes induced by viral infection in human dendritic cells (DCs). DDX60 expression correlated strongly with immune checkpoint and immune system-related metagene clusters, and DDX60 promoted cell proliferation, migration, and invasion and was related to poor prognosis and immune resistance(PMID: 37274827). Involved in RIG-I-dependent and independent innate immune responses, DDX60 has been proven to be associated with the development of tumors.
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for DDX60 antibody 82969-4-RR | Download protocol |
IF protocol for DDX60 antibody 82969-4-RR | Download protocol |
FC protocol for DDX60 antibody 82969-4-RR | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |