DEFA1 Monoclonal antibody, PBS Only

• 

  WB analysis of human peripheral blood leukocyte using 67156-1-Ig (same clone as 67156-1-PBS)

  Human peripheral blood leukocyte cells were subjected to SDS PAGE followed by western blot with 67156-1-Ig (DEFA1 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67156-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 67156-1-Ig (same clone as 67156-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 67156-1-Ig (DEFA1 antibody) at dilution of 1:2000 (under 10x lens). This data was developed using the same antibody clone with 67156-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 67156-1-Ig (same clone as 67156-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 67156-1-Ig (DEFA1 antibody) at dilution of 1:2000 (under 40x lens). This data was developed using the same antibody clone with 67156-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse spleen using 67156-1-Ig (same clone as 67156-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse spleen tissue using DEFA1 antibody (67156-1-Ig, Clone: 1A2B3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67156-1-PBS in a different storage buffer formulation.

DEFA1 Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 67156-1-PBS

Clone No.1A2B3

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

1A2B3, DEFA 1, DEFA1B, DEFA2, defensin, alpha 1

---

Product Information

67156-1-PBS targets DEFA1 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12592

  Product name: Recombinant human DEFA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-94 aa of BC093791

  Sequence: MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC

• Full Name: defensin, alpha 1
• Calculated Molecular Weight: 94 aa, 10 kDa
• Observed Molecular Weight: 6-10 kDa
• GenBank Accession Number: BC093791
• Gene Symbol: DEFA1
• Gene ID (NCBI): 1667
• RRID: AB_2882453
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P59665
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.