Product Information
67156-1-PBS targets DEFA1 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Mouse / IgG2b |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag12592 Product name: Recombinant human DEFA1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-94 aa of BC093791 Sequence: MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC Predict reactive species |
Full Name | defensin, alpha 1 |
Calculated Molecular Weight | 94 aa, 10 kDa |
Observed Molecular Weight | 6-10 kDa |
GenBank Accession Number | BC093791 |
Gene Symbol | DEFA1 |
Gene ID (NCBI) | 1667 |
RRID | AB_2882453 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P59665 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |