Product Information
67156-1-PBS targets DEFA1 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12592 Product name: Recombinant human DEFA1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-94 aa of BC093791 Sequence: MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC Predict reactive species |
| Full Name | defensin, alpha 1 |
| Calculated Molecular Weight | 94 aa, 10 kDa |
| Observed Molecular Weight | 6-10 kDa |
| GenBank Accession Number | BC093791 |
| Gene Symbol | DEFA1 |
| Gene ID (NCBI) | 1667 |
| RRID | AB_2882453 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P59665 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |







