Tested Applications
| Positive WB detected in | Human peripheral blood leukocyte cells |
| Positive IHC detected in | human small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse spleen tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:5000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67156-1-Ig targets DEFA1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12592 Product name: Recombinant human DEFA1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-94 aa of BC093791 Sequence: MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC Predict reactive species |
| Full Name | defensin, alpha 1 |
| Calculated Molecular Weight | 94 aa, 10 kDa |
| Observed Molecular Weight | 6-10 kDa |
| GenBank Accession Number | BC093791 |
| Gene Symbol | DEFA1 |
| Gene ID (NCBI) | 1667 |
| RRID | AB_2882453 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P59665 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for DEFA1 antibody 67156-1-Ig | Download protocol |
| IHC protocol for DEFA1 antibody 67156-1-Ig | Download protocol |
| WB protocol for DEFA1 antibody 67156-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







