Tested Applications
| Positive WB detected in | mouse heart tissue, human heart tissue, rat heart tissue |
| Positive IP detected in | mouse heart tissue |
| Positive IHC detected in | human appendicitis tissue, human colon tissue, human heart tissue, human hysteromyoma tissue, human placenta tissue, human skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat heart tissue, mouse heart tissue |
| Positive IF/ICC detected in | C2C12 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:20000-1:100000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:4000-1:16000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 48 publications below |
| IHC | See 11 publications below |
| IF | See 41 publications below |
| IP | See 2 publications below |
Product Information
16520-1-AP targets Desmin in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey, chicken, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9742 Product name: Recombinant human Desmin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 121-470 aa of BC032116 Sequence: NYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVERDNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL Predict reactive species |
| Full Name | desmin |
| Calculated Molecular Weight | 470 aa, 54 kDa |
| Observed Molecular Weight | 52-53 kDa |
| GenBank Accession Number | BC032116 |
| Gene Symbol | Desmin |
| Gene ID (NCBI) | 1674 |
| RRID | AB_2292918 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P17661 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Desmin is the main intermediate filament protein in skeletal and cardiac muscle cells and is essential for both the structural integrity and the survival of muscle cells. As an abundant muscle-specific protein, desmin has been widely used as a marker of muscle derived tumors. Anti-desmin is also valuable in the differential diagnosis of tumors of uncertain origin.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Desmin antibody 16520-1-AP | Download protocol |
| IHC protocol for Desmin antibody 16520-1-AP | Download protocol |
| IP protocol for Desmin antibody 16520-1-AP | Download protocol |
| WB protocol for Desmin antibody 16520-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther The AKAP12-PKA axis regulates lipid homeostasis during alcohol-associated liver disease | ||
Theranostics miR-17-3p Contributes to Exercise-Induced Cardiac Growth and Protects against Myocardial Ischemia-Reperfusion Injury. | ||
Acta Physiol (Oxf) Podocyte apoptosis in diabetic nephropathy by BASP1 activation of the p53 pathway via WT1. | ||
Oxid Med Cell Longev Tanreqing Injection Regulates Cell Function of Hypoxia-Induced Human Pulmonary Artery Smooth Muscle Cells (HPASMCs) through TRPC1/CX3CL1 Signaling Pathway. | ||
J Invest Dermatol TRAF6 Activates Fibroblasts to Cancer-Associated Fibroblasts through FGF19 in Tumor Microenvironment to Benefit the Malignant Phenotype of Melanoma Cells. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Kamal (Verified Customer) (01-26-2024) | Antibody diluted in 1X PBS, dilution 1:50000, worked well for western blot analysis in mouse liver tissues.
|
FH Brice-Emmanuel (Verified Customer) (09-12-2023) | Perfect if you want to see bandes of degraded desmin. I diluted the antibody 1:5000 in NFDM5%.
|
FH Víctor (Verified Customer) (06-12-2023) | It is a good marker for muscle cells. Indeed, sarcomeric structures can be seen with this antibody. High specificity and low background.
![]() |
FH Sarah (Verified Customer) (11-16-2019) | This antibody worked well for both WB (1:4000 for 1 hour) and IP (1.6ug Ab/ 500ug Protein)
![]() |

































