• Featured Product
  • KD/KO Validated

CoraLite® Plus 647-conjugated Desmin Polyclonal antibody

Desmin Polyclonal Antibody for IF-P, FC (Intra)
Cat No. CL647-16520

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P, FC (Intra)

DES

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse heart tissue
Positive FC (Intra) detected inC2C12 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-16520 targets Desmin in IF-P, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9742

Product name: Recombinant human Desmin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 121-470 aa of BC032116

Sequence: NYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVERDNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL

Predict reactive species
Full Name desmin
Calculated Molecular Weight 470 aa, 54 kDa
Observed Molecular Weight 52-53 kDa
GenBank Accession NumberBC032116
Gene Symbol Desmin
Gene ID (NCBI) 1674
RRIDAB_2920232
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP17661
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Desmin is the main intermediate filament protein in skeletal and cardiac muscle cells and is essential for both the structural integrity and the survival of muscle cells. As an abundant muscle-specific protein, desmin has been widely used as a marker of muscle derived tumors. Anti-desmin is also valuable in the differential diagnosis of tumors of uncertain origin.

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 Desmin antibody CL647-16520Download protocol
IF protocol for CL Plus 647 Desmin antibody CL647-16520Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...