Product Information
82945-1-PBS targets DGAT1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag32717 Product name: Recombinant human DGAT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 200-300 aa of BC015762 Sequence: AHTILFLKLFSYRDVNSWCRRARAKAASAGKKASSAAAPHTVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWM Predict reactive species |
| Full Name | diacylglycerol O-acyltransferase homolog 1 (mouse) |
| Calculated Molecular Weight | 488 aa, 55 kDa |
| GenBank Accession Number | BC015762 |
| Gene Symbol | DGAT1 |
| Gene ID (NCBI) | 8694 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O75907 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |





