DGAT1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 82945-1-RR (same clone as 82945-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82945-1-RR (DGAT1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82945-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 82945-1-RR (same clone as 82945-1-PBS)

  WB result of DGAT1 antibody (82945-1-RR; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DGAT1 transfected HeLa cells. This data was developed using the same antibody clone with 82945-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 82945-1-RR (same clone as 82945-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82945-1-RR (DGAT1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82945-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

DGAT1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 82945-1-PBS

Clone No.230091E1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

DGAT, ARAT, AGRP1, Acyl-CoA retinol O-fatty-acyltransferase, ACAT-related gene product 1

---

Product Information

82945-1-PBS targets DGAT1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag32717

  Product name: Recombinant human DGAT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 200-300 aa of BC015762

  Sequence: AHTILFLKLFSYRDVNSWCRRARAKAASAGKKASSAAAPHTVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWM

• Full Name: diacylglycerol O-acyltransferase homolog 1 (mouse)
• Calculated Molecular Weight: 488 aa, 55 kDa
• GenBank Accession Number: BC015762
• Gene Symbol: DGAT1
• Gene ID (NCBI): 8694
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75907
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.