DGAT1 Recombinant monoclonal antibody

• 

  WB analysis using 82945-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 82945-1-RR (DGAT1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 82945-1-RR

  WB result of DGAT1 antibody (82945-1-RR; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DGAT1 transfected HeLa cells.

• 

  WB analysis using 82945-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 82945-1-RR (DGAT1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

DGAT1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 82945-1-RR

Clone No.230091E1

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat and More (1)

Applications

WB, ELISA

Synonyms

ACAT related gene product 1, AGRP1, ARGP1, DGAT, DGAT1, Diglyceride acyltransferase

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse liver tissue, HepG2 cells, PC-3 cells, THP-1 cells, Caco-2 cells, rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below

Product Information

82945-1-RR targets DGAT1 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag32717

  Product name: Recombinant human DGAT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 200-300 aa of BC015762

  Sequence: AHTILFLKLFSYRDVNSWCRRARAKAASAGKKASSAAAPHTVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWM

• Full Name: diacylglycerol O-acyltransferase homolog 1 (mouse)
• Calculated Molecular Weight: 488 aa, 55 kDa
• Observed Molecular Weight: 45-55 kDa
• GenBank Accession Number: BC015762
• Gene Symbol: DGAT1
• Gene ID (NCBI): 8694
• RRID: AB_3391728
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75907
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Phytomedicine; Integrated metabolomics and mass spectrometry imaging analysis reveal the efficacy and mechanism of Huangkui capsule on type 2 diabetic nephropathy; Authors - Jinwei Han
mouse	WB	Biochim Biophys Acta Mol Cell Biol Lipids; Inducible global knockout of surfeit locus protein 4 in adult mice results in hypolipidemia, intestinal lipid accumulation, liver injury, and increased mortality; Authors - Wei Chen
human	WB	World J Hepatol; Chromatin accessibility module identified by single-cell sequencing underlies the diagnosis and prognosis of hepatocellular carcinoma; Authors - Xiao-Li Xi
	WB	Cell Rep; STBD1 mediates the crosstalk between glycogen and lipid droplets in clear cell renal cell carcinoma; Authors - Hao Wang
human	WB	FEBS J; Human transmembrane protein 68 links triacylglycerol synthesis to membrane lipid homeostasis; Authors - Fansi Zeng