Tested Applications
| Positive WB detected in | U2OS cells, LNCaP cells, HeLa cells, HEK-293 cells, K-562 cells, Jurkat cells, Ramos cells, Sp2/0 cells |
| Positive IP detected in | Jurkat cells |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
68375-1-Ig targets DICER1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with Human, mouse samples.
| Tested Reactivity | Human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30368 Product name: Recombinant human DICER1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 432-534 aa of NM_030621 Sequence: TNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHGIGKNQPRNKQMEAEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLV Predict reactive species |
| Full Name | dicer 1, ribonuclease type III |
| Calculated Molecular Weight | 219 kDa |
| Observed Molecular Weight | 240-250 kDa |
| GenBank Accession Number | NM_030621 |
| Gene Symbol | DICER1 |
| Gene ID (NCBI) | 23405 |
| RRID | AB_3085094 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q9UPY3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DICER1 functions as a ribonuclease and is required by the RNA interference and small temporal RNA (stRNA) pathways to produce the active small RNA component that represses gene expression. DICER1 cleaves naturally occurring long dsRNAs and short hairpin pre-microRNAs (miRNA) into fragments of twenty-one to twenty-three nucleotides with 3' overhang of two nucleotides, and producing respectively short interfering RNAs (siRNA) and mature microRNAs. SiRNAs and miRNAs serve as guide to direct the RNA-induced silencing complex (RISC) to complementary RNAs to degrade them or prevent their translation.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for DICER1 antibody 68375-1-Ig | Download protocol |
| IP protocol for DICER1 antibody 68375-1-Ig | Download protocol |
| WB protocol for DICER1 antibody 68375-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Aleksandr (Verified Customer) (11-10-2024) | Great antibody, that were used to probe for Dicer1 in human RKO cells
![]() |
FH Tsimafei (Verified Customer) (08-07-2024) | Excellent antibody for Dicer1
![]() |
FH Laurens (Verified Customer) (08-01-2023) | Antibody worked excellently on western blot. On par or even better than the D38E7 antibody from Cell Signalling, despite using a lower dilution of the Proteintech antibody. Will turn out to be a cheaper and better alternative.
|







