DICER1 Monoclonal antibody, PBS Only

• 

  WB analysis of U2OS using 68375-1-Ig (same clone as 68375-1-PBS)

  U2OS cells were subjected to SDS PAGE followed by western blot with 68375-1-Ig (DICER1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68375-1-PBS in a different storage buffer formulation.

• 

  IP experiment of Jurkat using 68375-1-Ig (same clone as 68375-1-PBS)

  IP result of anti-DICER1 (IP:68375-1-Ig, 4ug; Detection:68375-1-Ig 1:500) with Jurkat cells lysate 1560 ug. This data was developed using the same antibody clone with 68375-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 68375-1-Ig (same clone as 68375-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using DICER1 antibody (68375-1-Ig, Clone: 1C8E2 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68375-1-PBS in a different storage buffer formulation.

DICER1 Monoclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 68375-1-PBS

Clone No.1C8E2

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

DCR1, Dicer, dicer 1, ribonuclease type III, DICER1, Endoribonuclease Dicer, Helicase MOI, Helicase with RNase motif, HERNA, KIAA0928

---

Product Information

68375-1-PBS targets DICER1 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30368

  Product name: Recombinant human DICER1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 432-534 aa of NM_030621

  Sequence: TNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHGIGKNQPRNKQMEAEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLV

• Full Name: dicer 1, ribonuclease type III
• Calculated Molecular Weight: 219 kDa
• Observed Molecular Weight: 240-250 kDa
• GenBank Accession Number: NM_030621
• Gene Symbol: DICER1
• Gene ID (NCBI): 23405
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9UPY3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DICER1 functions as a ribonuclease and is required by the RNA interference and small temporal RNA (stRNA) pathways to produce the active small RNA component that represses gene expression. DICER1 cleaves naturally occurring long dsRNAs and short hairpin pre-microRNAs (miRNA) into fragments of twenty-one to twenty-three nucleotides with 3' overhang of two nucleotides, and producing respectively short interfering RNAs (siRNA) and mature microRNAs. SiRNAs and miRNAs serve as guide to direct the RNA-induced silencing complex (RISC) to complementary RNAs to degrade them or prevent their translation.