Tested Applications
Positive WB detected in | K-562 cells, A549 cells |
Positive IHC detected in | human colon cancer tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
11860-1-AP targets DLEU1 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2435 Product name: Recombinant human DLEU1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-78 aa of BC020692 Sequence: MRPCIWIHVHLKPPCRLVELLPFSSALQGLSHLSLGTTLPVILPERNEEQNLQELSHNADKYQMGDCCKEEIDDSIFY Predict reactive species |
Full Name | deleted in lymphocytic leukemia 1 (non-protein coding) |
Calculated Molecular Weight | 78 aa, 9 kDa |
Observed Molecular Weight | 27-30 kDa |
GenBank Accession Number | BC020692 |
Gene Symbol | DLEU1 |
Gene ID (NCBI) | 10301 |
RRID | AB_874117 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O43261 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for DLEU1 antibody 11860-1-AP | Download protocol |
IHC protocol for DLEU1 antibody 11860-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |