DMT1 Recombinant monoclonal antibody, PBS Only

DMT1 Uni-rAb® Recombinant Antibody for Indirect ELISA, IP, WB
Cat No. 81609-1-PBS
Clone No.1I13

Host / Isotype

Rabbit / IgG

Reactivity

rat, mouse, human

Applications

Indirect ELISA, IP, WB

SLC11A2, OK/SW-cl.20, Natural resistance-associated macrophage protein 2, DMT-1, DCT1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

81609-1-PBS targets DMT1 in Indirect ELISA, IP, WB applications and shows reactivity with rat, mouse, human samples.

Tested Reactivity rat, mouse, human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag14314

Product name: Recombinant human SLC11A2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-80 aa of BC002592

Sequence: MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCFSFRKLWAFTGPGFLM

Predict reactive species
Full Name solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2
Calculated Molecular Weight 568 aa, 62 kDa
Observed Molecular Weight 70 kDa
GenBank Accession NumberBC002592
Gene Symbol DMT1
Gene ID (NCBI) 4891
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP49281
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SLC11A2 (also known as DMT1, Nramp2, and DCT1) is a member of the divalent cation transporters that plays a central role in iron homeostasis. SLC11A2 is widely expressed in many tissues including brain, kidney, testis, duodenum and placenta. As a membrane protein, SLC11A2 is localized on the apical membrane of enterocytes as well as in transferrin-cycle endosomes. Four isoforms of SLC11A2 exist due to the alternative splicing. They differ at the NH2 and COOH termini but share a common central domain. A variety of molecular weights of SLC11A2 in western blot analysis, ranging from 50 to 100 kDa, has been reported in different cells and species. The differences in molecular weights may be attributed to the level of glycosylation, proteolysis, or the membrane protein itself. This antibody detected various forms of SLC11A2 of 45-100 kDa.

Loading...
||
New chat Able
正在加载,请稍候...