Tested Applications
Positive WB detected in | HeLa cells, HepG2 cells, HEK-293 cells, HuH-7 cells, Caco-2 cells, Neuro-2a cells, HSC-T6 cells |
Positive IP detected in | HEK-293 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
81609-1-RR targets DMT1 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag14314 Product name: Recombinant human SLC11A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC002592 Sequence: MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCFSFRKLWAFTGPGFLM Predict reactive species |
Full Name | solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2 |
Calculated Molecular Weight | 568 aa, 62 kDa |
Observed Molecular Weight | 70 kDa |
GenBank Accession Number | BC002592 |
Gene Symbol | DMT1 |
Gene ID (NCBI) | 4891 |
RRID | AB_2935564 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P49281 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC11A2 (also known as DMT1, Nramp2, and DCT1) is a member of the divalent cation transporters that plays a central role in iron homeostasis. SLC11A2 is widely expressed in many tissues including brain, kidney, testis, duodenum and placenta. As a membrane protein, SLC11A2 is localized on the apical membrane of enterocytes as well as in transferrin-cycle endosomes. Four isoforms of SLC11A2 exist due to the alternative splicing. They differ at the NH2 and COOH termini but share a common central domain. A variety of molecular weights of SLC11A2 in western blot analysis, ranging from 50 to 100 kDa, has been reported in different cells and species. The differences in molecular weights may be attributed to the level of glycosylation, proteolysis, or the membrane protein itself. This antibody detected various forms of SLC11A2 of 45-100 kDa.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for DMT1 antibody 81609-1-RR | Download protocol |
IP protocol for DMT1 antibody 81609-1-RR | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Amandine (Verified Customer) (02-06-2024) | With 20ug of protein denatured or not, 1H30 RT 1/10000, secondary antibody 2h 1/5000. Chemiluminescence revelation, 6min of exposition
![]() |