DMT1 Recombinant monoclonal antibody

DMT1 Uni-rAb® Recombinant Antibody for WB, IP, ELISA
Cat No. 81609-1-RR
Clone No.1I13

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

SLC11A2, OK/SW-cl.20, Natural resistance-associated macrophage protein 2, DMT-1, DCT1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, HEK-293 cells, HuH-7 cells, Caco-2 cells, Neuro-2a cells, HSC-T6 cells
Positive IP detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 2 publications below

Product Information

81609-1-RR targets DMT1 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag14314

Product name: Recombinant human SLC11A2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-80 aa of BC002592

Sequence: MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCFSFRKLWAFTGPGFLM

Predict reactive species
Full Name solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2
Calculated Molecular Weight 568 aa, 62 kDa
Observed Molecular Weight 70 kDa
GenBank Accession NumberBC002592
Gene Symbol DMT1
Gene ID (NCBI) 4891
RRIDAB_2935564
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP49281
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC11A2 (also known as DMT1, Nramp2, and DCT1) is a member of the divalent cation transporters that plays a central role in iron homeostasis. SLC11A2 is widely expressed in many tissues including brain, kidney, testis, duodenum and placenta. As a membrane protein, SLC11A2 is localized on the apical membrane of enterocytes as well as in transferrin-cycle endosomes. Four isoforms of SLC11A2 exist due to the alternative splicing. They differ at the NH2 and COOH termini but share a common central domain. A variety of molecular weights of SLC11A2 in western blot analysis, ranging from 50 to 100 kDa, has been reported in different cells and species. The differences in molecular weights may be attributed to the level of glycosylation, proteolysis, or the membrane protein itself. This antibody detected various forms of SLC11A2 of 45-100 kDa.

Protocols

Product Specific Protocols
IP protocol for DMT1 antibody 81609-1-RRDownload protocol
WB protocol for DMT1 antibody 81609-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Free Radic Biol Med

Ferredoxin 1-like maintains iron homeostasis and hepatoma cell survival

Authors - Jie Zheng
ratWB

Eur J Med Res

Low doses of ozone alleviate cardiomyocyte ferroptosis induced by hypoxia-reoxygenation injury via the AMPK-mTOR pathway

Authors - Yu Ding

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Amandine (Verified Customer) (02-06-2024)

With 20ug of protein denatured or not, 1H30 RT 1/10000, secondary antibody 2h 1/5000. Chemiluminescence revelation, 6min of exposition

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/10000
  • Cell Tissue Type: ImCC
DMT1 Antibody Western Blot validation (1/10000 dilution) in ImCC (Cat no:81609-1-RR)
Loading...
||
New chat Able
正在加载,请稍候...