DNAH5 Polyclonal antibody, PBS Only

• 

  IHC staining of human lung using 31079-1-AP (same clone as 31079-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 31079-1-AP (DNAH5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31079-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 31079-1-AP (same clone as 31079-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 31079-1-AP (DNAH5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31079-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 31079-1-AP (same clone as 31079-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using DNAH5 antibody (31079-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 31079-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 31079-1-AP (same clone as 31079-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using DNAH5 antibody (31079-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red). This data was developed using the same antibody clone with 31079-1-PBS in a different storage buffer formulation.

DNAH5 Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 31079-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

KIAA1603, HL1, Dynein heavy chain 5, axonemal, DNAHC5, Ciliary dynein heavy chain 5

---

Product Information

31079-1-PBS targets DNAH5 in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34647

  Product name: Recombinant human DNAH5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 50-150 aa of NM_001369

  Sequence: LNKTEVEDAILEGNQIERIDQLFAVGGLRHLMFYYQDVEEAETGQLGSLGGVNLVSGKIKKPKVFVTEGNDVALTGVCVFFIRTDPSKAITPDNIHQEVSF

• Full Name: dynein, axonemal, heavy chain 5
• Calculated Molecular Weight: 529 kDa
• GenBank Accession Number: NM_001369
• Gene Symbol: DNAH5
• Gene ID (NCBI): 1767
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8TE73
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Dynein axonemal heavy chain 5 (DNAH5) is an axonemal heavy chain dynein, part of a microtubule-associated motor protein complex. DNAH5 is a large gene comprising 79 exons and one alternative first exon and encodes a heavy chain of the ODA. We have recently shown that recessive DNAH5 mutations are responsible for PCD characterized by ODA defects. DNAH5 mutations cause PCD and randomization of left-right asymmetry (PMID: 15750039).